Align Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; HPAT; HspAT; EC 2.6.1.9 (characterized)
to candidate WP_057506749.1 ABB28_RS00535 histidinol-phosphate transaminase
Query= SwissProt::P06986 (356 letters) >NCBI__GCF_001431535.1:WP_057506749.1 Length = 364 Score = 273 bits (698), Expect = 5e-78 Identities = 150/357 (42%), Positives = 212/357 (59%), Gaps = 6/357 (1%) Query: 2 STVTITDLARENVRNLTPYQSARRLGGNGDVWLNANEYPTAVEFQLTQQTLNRYPECQPK 61 S + L R ++++ Y SAR GDVWLNANE A + + RYP+ QP Sbjct: 4 SVQDVLALLRPDLQSFAGYSSARSTALQGDVWLNANESAWANPADASGSS-RRYPDPQPP 62 Query: 62 AVIENYAQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSVSAETIG 121 A+++ A GV P+Q+LV RG+DE I+LL+RAFC PG DA+L PP +GMY+V A G Sbjct: 63 ALLQALAGLYGVSPQQLLVGRGSDEAIDLLVRAFCRPGVDAVLATPPVFGMYAVCARLQG 122 Query: 122 VECRTVPTLDN---WQLDLQGI--SDKLDGVKVVYVCSPNNPTGQLINPQDFRTLLELTR 176 VP +D+ Q+DL + + + G ++V++CSP+NP G I+ D + + Sbjct: 123 APLLEVPLVDSPAGLQVDLDAVIATARGQGARLVFLCSPSNPAGSEISAADIARTAQALQ 182 Query: 177 GKAIVVADEAYIEFCPQASLAGWLAEYPHLAILRTLSKAFALAGLRCGFTLANEEVINLL 236 G+A+VV DEAYIE+ Q S LA YP+LA+LRTLSKA ALA R G +A E+I L Sbjct: 183 GQAVVVVDEAYIEYSGQPSATALLAHYPNLAVLRTLSKAHALAAARVGSLIAAPEIIAAL 242 Query: 237 MKVIAPYPLSTPVADIAAQALSPQGIVAMRERVAQIIAEREYLIAALKEIPCVEQVFDSE 296 + APYP+ P A++A AL P + A R R+ ++ ER L AL + V QV+ S Sbjct: 243 RRCQAPYPVPQPCAELAVAALQPAALAATRARIDDVVRERARLSDALAGVDGVRQVYPSA 302 Query: 297 TNYILARFKASSAVFKSLWDQGIILRDQNKQPSLSGCLRITVGTREESQRVIDALRA 353 NY+L RF + F +L G+++RDQ P L LRI++G+ +E+QRV+ AL A Sbjct: 303 GNYLLVRFDDAQGAFDALLAAGVVVRDQRAAPQLGDALRISIGSTDENQRVLAALSA 359 Lambda K H 0.319 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 386 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 364 Length adjustment: 29 Effective length of query: 327 Effective length of database: 335 Effective search space: 109545 Effective search space used: 109545 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_057506749.1 ABB28_RS00535 (histidinol-phosphate transaminase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.29505.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-110 353.8 0.0 4.9e-110 353.6 0.0 1.0 1 lcl|NCBI__GCF_001431535.1:WP_057506749.1 ABB28_RS00535 histidinol-phospha Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001431535.1:WP_057506749.1 ABB28_RS00535 histidinol-phosphate transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 353.6 0.0 4.9e-110 4.9e-110 1 347 [. 13 358 .. 13 360 .. 0.96 Alignments for each domain: == domain 1 score: 353.6 bits; conditional E-value: 4.9e-110 TIGR01141 1 rekikklepYqpgarelgekevvkLnsnEnPfgpsekvkealkeelkklhrYpdpqalelkealakylg 69 r+++++++ Y++ ar+++ +++v+Ln+nE++++++ +++ + +rYpdpq+ +l +ala +g lcl|NCBI__GCF_001431535.1:WP_057506749.1 13 RPDLQSFAGYSS-ARSTALQGDVWLNANESAWANPA----DASG---SSRRYPDPQPPALLQALAGLYG 73 7899********.9*********************3....3333...369******************* PP TIGR01141 70 veeenillgnGsdelielliraflepg.davlvleptysmYevsakiagaevkevplked...gqedle 134 v+++++l+g+Gsde+i+ll+raf+ pg davl+++p + mY+v+a+++ga + evpl ++ q dl+ lcl|NCBI__GCF_001431535.1:WP_057506749.1 74 VSPQQLLVGRGSDEAIDLLVRAFCRPGvDAVLATPPVFGMYAVCARLQGAPLLEVPLVDSpagLQVDLD 142 ***********************************************************9998666777 PP TIGR01141 135 avle.aakekvklvflasPnnPtGnllkreeiekvleeve.dalVVvDeAYieFseeasvlellaeypn 201 av + a+ + ++lvfl+sP+nP G+ +++++i + +++ + +a+VVvDeAYie+s+++s++ lla+ypn lcl|NCBI__GCF_001431535.1:WP_057506749.1 143 AVIAtARGQGARLVFLCSPSNPAGSEISAADIARTAQALQgQAVVVVDEAYIEYSGQPSATALLAHYPN 211 6665499999*****************************77**************************** PP TIGR01141 202 lvvlrTlSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsd..kiektveevkk 268 l+vlrTlSKa++LA+ RvG +ia +eii al++++apy+v+++++e+avaal+ ++ +++++++v + lcl|NCBI__GCF_001431535.1:WP_057506749.1 212 LAVLRTLSKAHALAAARVGSLIAAPEIIAALRRCQAPYPVPQPCAELAVAALQPAAlaATRARIDDVVR 280 *******************************************************999999******** PP TIGR01141 269 ererlleelkklegle.vyeSkaNFvlikvkedaeelleallekgiivRdlksaeglleeclRitvGtr 336 er+rl ++l+ ++g++ vy+S +N++l++++ da+ +++all +g++vRd+++a++ l ++lRi++G+ lcl|NCBI__GCF_001431535.1:WP_057506749.1 281 ERARLSDALAGVDGVRqVYPSAGNYLLVRFD-DAQGAFDALLAAGVVVRDQRAAPQ-LGDALRISIGST 347 ******************************9.********************9976.6*********** PP TIGR01141 337 eenerllealk 347 +en+r+l+al+ lcl|NCBI__GCF_001431535.1:WP_057506749.1 348 DENQRVLAALS 358 ********996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (364 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.18 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory