Align IGP synthase cyclase subunit; EC 4.1.3.- (characterized)
to candidate WP_057506753.1 ABB28_RS00555 imidazole glycerol phosphate synthase subunit HisF
Query= CharProtDB::CH_024847 (258 letters) >NCBI__GCF_001431535.1:WP_057506753.1 Length = 258 Score = 335 bits (859), Expect = 6e-97 Identities = 167/256 (65%), Positives = 200/256 (78%), Gaps = 1/256 (0%) Query: 1 MLAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRV 60 ML++RIIPCLDVRDG+VVKGV+FR+H +GDI LA RY ++GADELVFYDI AS DGR Sbjct: 1 MLSRRIIPCLDVRDGRVVKGVRFRDHVDMGDIAELALRYRDQGADELVFYDIGASPDGRS 60 Query: 61 VDKSWVSRVAEVIDIPFCVAGGIKSLEDAAKILSFGADKISINSPALADPTLITRLADRF 120 VD W+ R+A +IDIPFCVAGGI +E A ++L GADKISINSPAL P LIT LAD F Sbjct: 61 VDVEWIERIARLIDIPFCVAGGISDVETARRVLHAGADKISINSPALGRPELITELADAF 120 Query: 121 GVQCIVVGIDTWYDAETGKYHVNQYTGDESRTRVTQWETLDWVQEVQKRGAGEIVLNMMN 180 GVQC+VVGID+ +A+ G++ V ++TGD S+T+ TLDWV+EVQ+RGAGEIVLN M+ Sbjct: 121 GVQCVVVGIDSVREAD-GQWRVRRFTGDPSKTQAVAVRTLDWVREVQQRGAGEIVLNCMD 179 Query: 181 QDGVRNGYDLEQLKKVREVCHVPLIASGGAGTMEHFLEAFRDADVDGALAASVFHKQIIN 240 DGVR GYD+EQL+ R CHVPLIASGGAG+ EHF + F ADVDGALAASVFH I Sbjct: 180 SDGVRRGYDVEQLRHARAACHVPLIASGGAGSREHFAQVFDQADVDGALAASVFHSGAIA 239 Query: 241 IGELKAYLATQGVEIR 256 I ELK YL Q +E+R Sbjct: 240 IPELKRYLREQQIEVR 255 Lambda K H 0.321 0.138 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 258 Length adjustment: 24 Effective length of query: 234 Effective length of database: 234 Effective search space: 54756 Effective search space used: 54756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate WP_057506753.1 ABB28_RS00555 (imidazole glycerol phosphate synthase subunit HisF)
to HMM TIGR00735 (hisF: imidazoleglycerol phosphate synthase, cyclase subunit)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00735.hmm # target sequence database: /tmp/gapView.14172.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00735 [M=254] Accession: TIGR00735 Description: hisF: imidazoleglycerol phosphate synthase, cyclase subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-106 338.8 0.2 1e-105 338.6 0.2 1.0 1 lcl|NCBI__GCF_001431535.1:WP_057506753.1 ABB28_RS00555 imidazole glycerol Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001431535.1:WP_057506753.1 ABB28_RS00555 imidazole glycerol phosphate synthase subunit HisF # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 338.6 0.2 1e-105 1e-105 1 254 [] 1 255 [. 1 255 [. 0.97 Alignments for each domain: == domain 1 score: 338.6 bits; conditional E-value: 1e-105 TIGR00735 1 mlakriipCLdvkdgrvvkGvqfknlrdaGdpvelakkydeeGadelvflditassekretmlevverv 69 ml++riipCLdv+dgrvvkGv+f+++ d+Gd+ ela +y ++Gadelvf+di as ++r++++e++er+ lcl|NCBI__GCF_001431535.1:WP_057506753.1 1 MLSRRIIPCLDVRDGRVVKGVRFRDHVDMGDIAELALRYRDQGADELVFYDIGASPDGRSVDVEWIERI 69 89******************************************************************* PP TIGR00735 70 aekvfiPltvgGGiksiedvkkllraGadkvsintaavkapelikeladrfGsqaivvaidakreaene 138 a+ ++iP++v+GGi+++e ++++l+aGadk+sin++a+ +peli+elad fG+q++vv+id+ rea+ lcl|NCBI__GCF_001431535.1:WP_057506753.1 70 ARLIDIPFCVAGGISDVETARRVLHAGADKISINSPALGRPELITELADAFGVQCVVVGIDSVREAD-- 136 ***************************************************************9997.. PP TIGR00735 139 eakyevtikgGres....tdldvvewakeveelGaGeilltsmdkdGtksGydlellkkvkeavkiPvi 203 ++++v +G+ s + + +++w++ev+++GaGei+l++md+dG+++Gyd+e+l++ + a+++P+i lcl|NCBI__GCF_001431535.1:WP_057506753.1 137 -GQWRVRRFTGDPSktqaVAVRTLDWVREVQQRGAGEIVLNCMDSDGVRRGYDVEQLRHARAACHVPLI 204 .68********9775444667889********************************************* PP TIGR00735 204 asgGaGkaehleeaflkgkadaaLaasvfhkreltieevkeylaergvkvr 254 asgGaG+ eh++++f ++++d+aLaasvfh + + i e+k+yl+e++++vr lcl|NCBI__GCF_001431535.1:WP_057506753.1 205 ASGGAGSREHFAQVFDQADVDGALAASVFHSGAIAIPELKRYLREQQIEVR 255 **************************************************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (254 nodes) Target sequences: 1 (258 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.03 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory