Align ATP phosphoribosyltransferase (characterized)
to candidate WP_057506747.1 ABB28_RS00525 ATP phosphoribosyltransferase
Query= CharProtDB::CH_024688 (299 letters) >NCBI__GCF_001431535.1:WP_057506747.1 Length = 303 Score = 229 bits (583), Expect = 8e-65 Identities = 125/293 (42%), Positives = 178/293 (60%), Gaps = 2/293 (0%) Query: 6 RLRIAMQKSGRLSDDSRELLARCGIKINLHTQRLIAMAENMPIDILRVRDDDIPGLVMDG 65 RLRIA+QK+GRL++ +R LL+ CG+ +L E++P+D+L VRDDDIPGL+ DG Sbjct: 12 RLRIAIQKNGRLAEPARNLLSACGLSWRESRDKLFCYGESLPVDLLLVRDDDIPGLIADG 71 Query: 66 VVDLGIIGENVLEEELLNRRAQGEDPRYFTLRRLDFGGCRLSLATPVDEAWDGPLSLNGK 125 V DLGI+G N L+E+ R +G P + LR L FG CRL LA P + W GP L G Sbjct: 72 VCDLGIVGRNELDEQGAARVQRGLKPAFQALRGLGFGACRLMLAVPEEWDWQGPQQLAGT 131 Query: 126 RIATSYPHLLKRYLDQKGISFKSCLLNGSVEVAPRAGLADAICDLVSTGATLEANGLREV 185 RIATSYP +LK +LD + I + L+GSVE+APR G AD ICDLVS+G TL AN L+ V Sbjct: 132 RIATSYPAILKDWLDARDIQAQVVELSGSVEIAPRLGTADLICDLVSSGGTLRANQLKPV 191 Query: 186 EVIYRSKACLIQRDGEMEESKQQLIDKLLTRIQGVIQARESKYIMMHAPTERLDEVIALL 245 E + S+A L ++++ L+ LL R+ GV+Q ++ K +M A + + LL Sbjct: 192 ETLLDSEAVLAGAVIAPDDARGALLAMLLRRLDGVVQVQDRKLLMFRAEPANVAALEKLL 251 Query: 246 PGAERPTILPLAGDQQRVAMHMVSSETLFWETMEKLKALGASSILVLPIEKMM 298 AE ++ L D + + L W+ ME+L+ GA ++VL +E+ + Sbjct: 252 ADAE--PLVRLPADDGAPRLQTMCPGPLSWQRMEELERAGAQGLMVLSVERSL 302 Lambda K H 0.320 0.137 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 303 Length adjustment: 27 Effective length of query: 272 Effective length of database: 276 Effective search space: 75072 Effective search space used: 75072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_057506747.1 ABB28_RS00525 (ATP phosphoribosyltransferase)
to HMM TIGR00070 (hisG: ATP phosphoribosyltransferase (EC 2.4.2.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00070.hmm # target sequence database: /tmp/gapView.23375.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00070 [M=183] Accession: TIGR00070 Description: hisG: ATP phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-57 178.9 0.0 6.1e-57 178.5 0.0 1.1 1 lcl|NCBI__GCF_001431535.1:WP_057506747.1 ABB28_RS00525 ATP phosphoribosyl Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001431535.1:WP_057506747.1 ABB28_RS00525 ATP phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 178.5 0.0 6.1e-57 6.1e-57 1 181 [. 13 201 .. 13 203 .. 0.97 Alignments for each domain: == domain 1 score: 178.5 bits; conditional E-value: 6.1e-57 TIGR00070 1 lriAlp.KGrleeetlkllekaglklskkeerkliasaedeevevlllrakdiptyvekgaadlGitGk 68 lriA++ Grl+e++ +ll+++gl+ ++++ +kl+ e +v++ll+r++dip +++g+ dlGi+G lcl|NCBI__GCF_001431535.1:WP_057506747.1 13 LRIAIQkNGRLAEPARNLLSACGLSWRESR-DKLFCYGESLPVDLLLVRDDDIPGLIADGVCDLGIVGR 80 89****99*****************99999.9************************************* PP TIGR00070 69 DlleEsead.........vvelldlgfgkcklvlAvpeesdvesledlkegkriATkypnltreylekk 128 + l E++a+ + l lgfg+c+l+lAvpee+d++ +++l+ g+riAT+yp + +++l+ + lcl|NCBI__GCF_001431535.1:WP_057506747.1 81 NELDEQGAArvqrglkpaFQALRGLGFGACRLMLAVPEEWDWQGPQQLA-GTRIATSYPAILKDWLDAR 148 *****998888999999888999**************************.9****************** PP TIGR00070 129 gvkveivkleGavElapllgladaIvDivetGttLrengLkiieeilessarl 181 +++++v+l+G+vE+ap+lg+ad+I+D+v++G tLr+n+Lk +e++l+s+a+l lcl|NCBI__GCF_001431535.1:WP_057506747.1 149 DIQAQVVELSGSVEIAPRLGTADLICDLVSSGGTLRANQLKPVETLLDSEAVL 201 ***************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (183 nodes) Target sequences: 1 (303 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 11.88 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory