Align putative bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase (EC 3.5.4.19; EC 3.6.1.31) (characterized)
to candidate WP_057506754.1 ABB28_RS00560 bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE
Query= metacyc::HISTCYCLOPRATPPHOS (203 letters) >NCBI__GCF_001431535.1:WP_057506754.1 Length = 206 Score = 214 bits (546), Expect = 7e-61 Identities = 114/194 (58%), Positives = 137/194 (70%), Gaps = 2/194 (1%) Query: 10 LDWEKTDGLMPVIVQHAVSGEVLMLGYMNPEALDKTLESGKVTFFSRTKQRLWTKGETSG 69 LDW K DGL+P ++Q A S +VLMLGY++ E+L TL++G +TFFSR+KQRLWTKGE SG Sbjct: 15 LDWSKGDGLLPAVLQDADSLQVLMLGYVSAESLQVTLQTGHMTFFSRSKQRLWTKGEQSG 74 Query: 70 NFLNVVSIAPDCDNDTLLVLANPIGPTCHKGTSSCFGDTAHQWLFLYQLEQLLAERKSAD 129 N L V SIA DCD DTLLV A P GPTCH G SCF F+ QL+QL+A R++ Sbjct: 75 NVLAVQSIAVDCDADTLLVRARPAGPTCHTGADSCFPQAPKD--FIGQLDQLVATREAQR 132 Query: 130 PETSYTAKLYASGTKRIAQKVGEEGVETALAATVHDRFELTNEASDLMYHLLVLLQDQGL 189 P SYT L+ G +RIAQKVGEEGVETALAA V EL EASDL++HLLVLL+ +GL Sbjct: 133 PAGSYTTSLFDGGIRRIAQKVGEEGVETALAAVVQGDDELLGEASDLVFHLLVLLRARGL 192 Query: 190 DLTTVIENLRKRHQ 203 L V L RH+ Sbjct: 193 GLQDVRTLLESRHR 206 Lambda K H 0.317 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 120 Number of extensions: 2 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 203 Length of database: 206 Length adjustment: 21 Effective length of query: 182 Effective length of database: 185 Effective search space: 33670 Effective search space used: 33670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 45 (21.9 bits)
Align candidate WP_057506754.1 ABB28_RS00560 (bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE)
to HMM TIGR03188 (hisE: phosphoribosyl-ATP diphosphatase (EC 3.6.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03188.hmm # target sequence database: /tmp/gapView.13920.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03188 [M=84] Accession: TIGR03188 Description: histidine_hisI: phosphoribosyl-ATP diphosphatase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.9e-30 89.4 0.0 9.4e-30 89.0 0.0 1.2 1 lcl|NCBI__GCF_001431535.1:WP_057506754.1 ABB28_RS00560 bifunctional phosp Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001431535.1:WP_057506754.1 ABB28_RS00560 bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 89.0 0.0 9.4e-30 9.4e-30 3 82 .. 120 199 .. 118 201 .. 0.97 Alignments for each domain: == domain 1 score: 89.0 bits; conditional E-value: 9.4e-30 TIGR03188 3 eLeevieerkeedpeeSytakllekgedkilkKvgEEavEviiaaknedkeelveEaaDllYhllVlla 71 +L+++++ r++++p +Syt++l++ g+++i++KvgEE vE+++aa+ + ++el+ Ea+Dl++hllVll+ lcl|NCBI__GCF_001431535.1:WP_057506754.1 120 QLDQLVATREAQRPAGSYTTSLFDGGIRRIAQKVGEEGVETALAAVVQGDDELLGEASDLVFHLLVLLR 188 89******************************************************************* PP TIGR03188 72 ekgvsledvla 82 ++g+ l+dv + lcl|NCBI__GCF_001431535.1:WP_057506754.1 189 ARGLGLQDVRT 199 ********965 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (84 nodes) Target sequences: 1 (206 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 6.39 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory