Align HAD family hydrolase (characterized, see rationale)
to candidate WP_057506825.1 ABB28_RS00915 HAD family phosphatase
Query= uniprot:A0A0L7BRC5 (209 letters) >NCBI__GCF_001431535.1:WP_057506825.1 Length = 220 Score = 105 bits (263), Expect = 5e-28 Identities = 71/212 (33%), Positives = 103/212 (48%), Gaps = 14/212 (6%) Query: 1 MANSPITDVIFDFCGVLLDWNTRACLEGKFPDDV-----VNRICANDDPCGFFHYEDRMD 55 + ++P + +IFD GVL+DWN R F D + +C+ + D Sbjct: 10 LPSAPPSSLIFDLGGVLIDWNPRYLYRTLFDDAAQMEHFLEHVCSPQ-------WNAAQD 62 Query: 56 AGEDLADILPDVRREQGDELAAIFEYYIAHYDDALPRTLPGMVELLEDLKAHGYGVWGLT 115 AG + ++ E + I Y++ + + L L G V LL +LKA G ++ LT Sbjct: 63 AGRSWEQAVDELAAEHPHQRELIAAYWL-RWQETLGDALHGTVALLAELKAAGVALYALT 121 Query: 116 NWSHETFHLAFEKFPRLEELLQGTVVSGVEKMHKPNADIYELALNHFGLTAGNCVFFDDT 175 NWS +TF +A E+F L +VSG E + KP+ I+E AL FG+ +F DD Sbjct: 122 NWSAQTFPIARERFGFLSAF-DDILVSGEEGLAKPDPRIFERALQRFGVEPSATLFIDDA 180 Query: 176 AKNIVGANEVGIHGLLFENALQARESLAQLGV 207 A N+ A GI LLF NA R SL LG+ Sbjct: 181 AANVQAAMGQGIPSLLFRNADSLRASLHALGL 212 Lambda K H 0.323 0.142 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 209 Length of database: 220 Length adjustment: 22 Effective length of query: 187 Effective length of database: 198 Effective search space: 37026 Effective search space used: 37026 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory