Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate WP_042613067.1 ABB28_RS07920 branched-chain amino acid aminotransferase
Query= BRENDA::A0R066 (368 letters) >NCBI__GCF_001431535.1:WP_042613067.1 Length = 364 Score = 424 bits (1090), Expect = e-123 Identities = 208/367 (56%), Positives = 268/367 (73%), Gaps = 4/367 (1%) Query: 1 MNSGPLEFTVSANTNPATDAVRESILANPGFGKYYTDHMVSIDYTVDEGWHNAQVIPYGP 60 M+ + F V+ + +P + R +IL PGFG ++TDHMV + + D GWHNA V PYGP Sbjct: 1 MSQSNISFDVTRSAHPRSADERAAILEKPGFGLHFTDHMVEVRWDKDTGWHNANVRPYGP 60 Query: 61 IQLDPSAIVLHYGQEIFEGLKAYRWADGSIVSFRPEANAARLQSSARRLAIPELPEEVFI 120 + LDP+A VLHYGQEIFEG+KAYR ADGS+ +FRP+AN RLQ SA+RLA+PELP ++F+ Sbjct: 61 LLLDPAAAVLHYGQEIFEGIKAYRHADGSVWTFRPDANGRRLQRSAQRLALPELPVDIFV 120 Query: 121 ESLRQLIAVDEKWVPPAGGEESLYLRPFVIATEPGLGVRPSNEYRYLLIASPAGAYFKGG 180 ESL+QL+A+D+ WVP A E SLY RPF+I E LGVR +++ Y +IASPAG YF G Sbjct: 121 ESLKQLVALDKDWVPSA-DESSLYFRPFMIGDEAFLGVRGAHKAGYYVIASPAGPYFAKG 179 Query: 181 IKPVSVWLSHEYVRASPGGTGAAKFGGNYAASLLAQAQAAEMGCDQVVWLDAIERRYVEE 240 + PVS+WLS EY RA+ GGTGAAK GGNYAASLL Q +A GC QV++LD E +Y+EE Sbjct: 180 VAPVSIWLSTEYARAAKGGTGAAKCGGNYAASLLPQQKAQAQGCSQVLFLDPTEGKYLEE 239 Query: 241 MGGMNLFFVFGSGGSARLVTPELSGSLLPGITRDSLLQLATDAGFAVEERKIDVDEWQKK 300 +GGMN+F V+ G LVTP+LSGS+L GITR+S+LQLA D G VEERK+ +DEW++ Sbjct: 240 LGGMNVFLVYKDG---TLVTPQLSGSILEGITRESILQLARDRGMKVEERKVSIDEWKQG 296 Query: 301 AGAGEITEVFACGTAAVITPVSHVKHHDGEFTIADGQPGEITMALRDTLTGIQRGTFADT 360 +GEITEVFACGTAAV+TP+ +K E + GE+T++LR LT IQ G D Sbjct: 297 VASGEITEVFACGTAAVVTPIGQLKGEGFEVGDINAPAGEVTLSLRKELTDIQYGRLPDR 356 Query: 361 HGWMARL 367 HGW+ +L Sbjct: 357 HGWLVKL 363 Lambda K H 0.318 0.135 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 465 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 368 Length of database: 364 Length adjustment: 30 Effective length of query: 338 Effective length of database: 334 Effective search space: 112892 Effective search space used: 112892 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_042613067.1 ABB28_RS07920 (branched-chain amino acid aminotransferase)
to HMM TIGR01123 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01123.hmm # target sequence database: /tmp/gapView.16999.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01123 [M=313] Accession: TIGR01123 Description: ilvE_II: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-146 473.3 0.0 1.7e-146 473.2 0.0 1.0 1 lcl|NCBI__GCF_001431535.1:WP_042613067.1 ABB28_RS07920 branched-chain ami Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001431535.1:WP_042613067.1 ABB28_RS07920 branched-chain amino acid aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 473.2 0.0 1.7e-146 1.7e-146 1 313 [] 50 363 .. 50 363 .. 1.00 Alignments for each domain: == domain 1 score: 473.2 bits; conditional E-value: 1.7e-146 TIGR01123 1 WdeaelaseaeleldegsavlhYgqevfeGlkayRtadGkillfRpdanakRlrrsaerlllPeleeel 69 W++a+++++++l ld+++avlhYgqe+feG+kayR+adG++++fRpdan +Rl+rsa+rl+lPel+ ++ lcl|NCBI__GCF_001431535.1:WP_042613067.1 50 WHNANVRPYGPLLLDPAAAVLHYGQEIFEGIKAYRHADGSVWTFRPDANGRRLQRSAQRLALPELPVDI 118 ********************************************************************* PP TIGR01123 70 flealkqlvkadkdwvpkakseasLYlRPfliatednlGvkaakeylflvlasPvGaYfkgglapvsif 138 f+e+lkqlv++dkdwvp+a+ e+sLY+RPf+i+ e+ lGv++a+++ ++v+asP+G+Yf++g+apvsi+ lcl|NCBI__GCF_001431535.1:WP_042613067.1 119 FVESLKQLVALDKDWVPSAD-ESSLYFRPFMIGDEAFLGVRGAHKAGYYVIASPAGPYFAKGVAPVSIW 186 *****************999.************************************************ PP TIGR01123 139 veteyvRaapkGtGavkvgGnYaasllaqkkaaeqglddvvyldpvekkkieevGaaniflitkdgelv 207 ++tey+Raa++GtGa+k+gGnYaasll+q+ka++qg+++v++ldp+e k++ee+G++n+fl++kdg+lv lcl|NCBI__GCF_001431535.1:WP_042613067.1 187 LSTEYARAAKGGTGAAKCGGNYAASLLPQQKAQAQGCSQVLFLDPTEGKYLEELGGMNVFLVYKDGTLV 255 ********************************************************************* PP TIGR01123 208 ttplsesiLegvtresllelakdlgleveereiaidelkaaveaGei..vfacGtaavitPvgelkieg 274 t++ls+siLeg+tres+l+la+d+g++veer+++ide+k+ v++Gei vfacGtaav+tP+g+lk eg lcl|NCBI__GCF_001431535.1:WP_042613067.1 256 TPQLSGSILEGITRESILQLARDRGMKVEERKVSIDEWKQGVASGEIteVFACGTAAVVTPIGQLKGEG 324 **********************************************999******************** PP TIGR01123 275 kevevkseevGevtkklrdeltdiqyGkledkegWivev 313 ev +++ Gevt +lr+eltdiqyG+l d++gW+v++ lcl|NCBI__GCF_001431535.1:WP_042613067.1 325 FEVGDINAPAGEVTLSLRKELTDIQYGRLPDRHGWLVKL 363 ************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (313 nodes) Target sequences: 1 (364 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.37 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory