Align dihydrodipicolinate reductase; EC 1.3.1.26 (characterized)
to candidate WP_083492033.1 ABB28_RS13580 4-hydroxy-tetrahydrodipicolinate reductase
Query= CharProtDB::CH_002128 (273 letters) >NCBI__GCF_001431535.1:WP_083492033.1 Length = 240 Score = 155 bits (393), Expect = 6e-43 Identities = 104/276 (37%), Positives = 153/276 (55%), Gaps = 44/276 (15%) Query: 1 MHDANIRVAIAGAGGRMGRQLIQAA------LALEGVQLGAA-LEREGSSLLGSDAGELA 53 M+ +R+ I GA GRMG+ L++ A L + G G A +R + A EL Sbjct: 1 MNQTPLRLLIHGASGRMGQALLRLAAEHTDTLNVVGAYTGRAPAQRVVDGIPHFAAKELH 60 Query: 54 GAGKTGVTVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQA 113 GA FDV IDF+ PEG LA C + G G+V GTTG +A ++A Sbjct: 61 GA---------------PPFDVAIDFSLPEGFDAILALCVERGAGLVSGTTGISQAQREA 105 Query: 114 IRDAAADIAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALA 173 + AA I +V+A+NFS+GV V+ +L+E+AA+ + + D +I+E+HH K+DAPSGTAL Sbjct: 106 LDAAAKAIPLVWASNFSLGVAVLDELVERAAQALAGW-DCDIVESHHTRKLDAPSGTALT 164 Query: 174 MGEAIAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEI 233 +G A R G T + +A++RAGDIVGEH F +GER+E+ Sbjct: 165 LG--------------AAAGRGGATPQ-------YASLRAGDIVGEHLVQFTGLGERIEL 203 Query: 234 THKASSRMTFANGAVRSALWLSGKESGLFDMRDVLD 269 H+A++R FA GA+ +A L + G + +RD+L+ Sbjct: 204 VHRATNRDIFARGALFAARQLGQRAPGSYRVRDLLN 239 Lambda K H 0.319 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 240 Length adjustment: 24 Effective length of query: 249 Effective length of database: 216 Effective search space: 53784 Effective search space used: 53784 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate WP_083492033.1 ABB28_RS13580 (4-hydroxy-tetrahydrodipicolinate reductase)
to HMM TIGR00036 (dapB: 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00036.hmm # target sequence database: /tmp/gapView.18469.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00036 [M=270] Accession: TIGR00036 Description: dapB: 4-hydroxy-tetrahydrodipicolinate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-59 186.7 0.1 1.4e-40 125.5 0.0 2.6 2 lcl|NCBI__GCF_001431535.1:WP_083492033.1 ABB28_RS13580 4-hydroxy-tetrahyd Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001431535.1:WP_083492033.1 ABB28_RS13580 4-hydroxy-tetrahydrodipicolinate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 125.5 0.0 1.4e-40 1.4e-40 2 176 .. 6 166 .. 5 170 .. 0.90 2 ! 58.3 0.0 4.3e-20 4.3e-20 203 269 .. 172 238 .. 166 239 .. 0.92 Alignments for each domain: == domain 1 score: 125.5 bits; conditional E-value: 1.4e-40 TIGR00036 2 ikvavaGaaGrmGrevikavkea.edlelvaalerkgsskqgkDiGelagigkvgvpveddleavkvla 69 +++ + Ga+GrmG+ +++ ++e+ + l++v+a ++ ++ D gi + ++l+ lcl|NCBI__GCF_001431535.1:WP_083492033.1 6 LRLLIHGASGRMGQALLRLAAEHtDTLNVVGAYTGRAPAQRVVD-----GIPHFAA---KELH-----G 61 6889**************98876588********8777777555.....6666665...3333.....3 PP TIGR00036 70 ekkadvliDfttpeavlenvkialekgvrlVvGTTGfseedlkelkdlaekkgvalviapNfaiGvnll 138 +dv iDf++pe+ + +++++e g lV+GTTG+s++++++l ++a+ ++lv a+Nf++Gv +l lcl|NCBI__GCF_001431535.1:WP_083492033.1 62 APPFDVAIDFSLPEGFDAILALCVERGAGLVSGTTGISQAQREALDAAAKA--IPLVWASNFSLGVAVL 128 579*******************************************99999..**************** PP TIGR00036 139 lkllekaakvledvDiEiiElHHrhKkDaPSGTAlkla 176 l+e aa+ l +D +i+E HH K DaPSGTAl l+ lcl|NCBI__GCF_001431535.1:WP_083492033.1 129 DELVERAAQALAGWDCDIVESHHTRKLDAPSGTALTLG 166 ***********************************875 PP == domain 2 score: 58.3 bits; conditional E-value: 4.3e-20 TIGR00036 203 kkeeiGiaavRggdvvgehtvlFasdGerleitHkassRaafakGvvrairwledkeekvydledvl 269 + ++ a++R+gd+vgeh v F++ Ger+e++H+a++R++fa+G++ a+r+l + + + y ++d+l lcl|NCBI__GCF_001431535.1:WP_083492033.1 172 GGATPQYASLRAGDIVGEHLVQFTGLGERIELVHRATNRDIFARGALFAARQLGQRAPGSYRVRDLL 238 455556799********************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (240 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.03 # Mc/sec: 1.79 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory