Align Diaminopimelate epimerase; DAP epimerase; EC 5.1.1.7; PLP-independent amino acid racemase (uncharacterized)
to candidate WP_057508891.1 ABB28_RS12205 diaminopimelate epimerase
Query= curated2:Q3BXU3 (284 letters) >NCBI__GCF_001431535.1:WP_057508891.1 Length = 292 Score = 428 bits (1100), Expect = e-125 Identities = 204/278 (73%), Positives = 234/278 (84%) Query: 6 RSGRLRFTKMHGAGNDFVVLDLRDGTPPPDAALAAQLADRHFGVGCDQILTIEAPRSEGA 65 R LRF+KMHGAGNDF+++DLRDGTPPP LAA+LADRH GVGCDQI+TIE PRS A Sbjct: 14 RGAPLRFSKMHGAGNDFIMIDLRDGTPPPSPQLAARLADRHTGVGCDQIITIEPPRSATA 73 Query: 66 VAAYGIWNSDGSAARQCGNGARCVAAWLVRDGTAQGERFIIDSPMSAHAVERLDGDRYAV 125 VA+Y IWNSDGS+++QCGNGARCVAAWLVR+G F IDSP++ H V L D +AV Sbjct: 74 VASYRIWNSDGSSSQQCGNGARCVAAWLVRNGDTADSEFAIDSPLATHPVRTLGEDHFAV 133 Query: 126 AMGVPQFEPAQIPLAGFAHARDEYALPVHGETVRFGAVSMGNPHAVVEVGRVDAAPVERV 185 MGVP FEPAQIPL GFAH RDEY LPV GETVRFGAVSMGNPHAV+EVG VDAAPVER+ Sbjct: 134 EMGVPVFEPAQIPLIGFAHPRDEYLLPVQGETVRFGAVSMGNPHAVIEVGLVDAAPVERL 193 Query: 186 GALLQQNAAFPDSVNVGFVQVVDPAHVRLRVFERGVGETLACGSGACAAAVVLMQRGRVE 245 GA LQQ+A+FP+SVNVGF QV++P H RLRV+ERGVGETLACGSGACAAAV LMQRGR+ Sbjct: 194 GASLQQHASFPESVNVGFAQVLEPDHARLRVYERGVGETLACGSGACAAAVSLMQRGRLG 253 Query: 246 RDVQVSLPGGELRIRWPGDQEQVVMSGPAVFVFDGEWN 283 D ++SLPGGELRI+W G+ + VVMSGP+ FVF+GEWN Sbjct: 254 PDARISLPGGELRIQWAGEGQPVVMSGPSAFVFEGEWN 291 Lambda K H 0.321 0.137 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 354 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 284 Length of database: 292 Length adjustment: 26 Effective length of query: 258 Effective length of database: 266 Effective search space: 68628 Effective search space used: 68628 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
Align candidate WP_057508891.1 ABB28_RS12205 (diaminopimelate epimerase)
to HMM TIGR00652 (dapF: diaminopimelate epimerase (EC 5.1.1.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00652.hmm # target sequence database: /tmp/gapView.26325.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00652 [M=270] Accession: TIGR00652 Description: DapF: diaminopimelate epimerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-78 250.3 0.0 1.3e-78 250.2 0.0 1.0 1 lcl|NCBI__GCF_001431535.1:WP_057508891.1 ABB28_RS12205 diaminopimelate ep Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001431535.1:WP_057508891.1 ABB28_RS12205 diaminopimelate epimerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 250.2 0.0 1.3e-78 1.3e-78 2 268 .. 19 290 .. 18 292 .] 0.96 Alignments for each domain: == domain 1 score: 250.2 bits; conditional E-value: 1.3e-78 TIGR00652 2 eFlkmhGlgNdFvlvdevdeelvkeeaelvrkvcdrhtgvgaDgvllvep.sseeadvklrifNsDGSe 69 +F+kmhG+gNdF+++d +d + + + ++l+++++drhtgvg+D+++++ep s +a + +ri+NsDGS+ lcl|NCBI__GCF_001431535.1:WP_057508891.1 19 RFSKMHGAGNDFIMIDLRDGTPPPS-PQLAARLADRHTGVGCDQIITIEPpRSATAVASYRIWNSDGSS 86 8******************999999.9**********************978889999*********** PP TIGR00652 70 aemCGNgiRcfakfvyekglkekkelsvetlaglikveveeenkkvkvdmgepkfkkeeipltvekeee 138 ++CGNg+Rc+a++++ +g + +e+ + + + v e+ + v+mg p f++++ipl + + + lcl|NCBI__GCF_001431535.1:WP_057508891.1 87 SQQCGNGARCVAAWLVRNGDTADSEFAIDSPLATHPVRTLGED-HFAVEMGVPVFEPAQIPLIGFAHPR 154 *********************99*******9999999999999.9******************999999 PP TIGR00652 139 keellalev..l...vvdvGnPHlvvfvedvekldleelgklleaheefpegvNvefvevkkedeiklr 202 +e+ll ++ + +v++GnPH+v+ v v+ +++e+lg+ l++h +fpe vNv f++v+++d+ +lr lcl|NCBI__GCF_001431535.1:WP_057508891.1 155 DEYLLPVQGetVrfgAVSMGNPHAVIEVGLVDAAPVERLGASLQQHASFPESVNVGFAQVLEPDHARLR 223 999998877663569****************************************************** PP TIGR00652 203 vyERGageTlaCGtGavAsavvalklgktkkkvtvhleggeLeievkedg.kvyltGpavlvlegel 268 vyERG+geTlaCG+Ga+A+av ++ g++ ++++ l+ggeL i++ +g v + Gp+ +v+ege lcl|NCBI__GCF_001431535.1:WP_057508891.1 224 VYERGVGETLACGSGACAAAVSLMQRGRLGPDARISLPGGELRIQWAGEGqPVVMSGPSAFVFEGEW 290 **************************************************99************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (292 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.87 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory