Align [amino group carrier protein]-gamma-(L-lysyl)-L-glutamate aminotransferase (EC 2.6.1.118) (characterized)
to candidate WP_057509163.1 ABB28_RS13760 glutamate-1-semialdehyde-2,1-aminomutase
Query= BRENDA::Q93R93 (395 letters) >NCBI__GCF_001431535.1:WP_057509163.1 Length = 426 Score = 139 bits (349), Expect = 2e-37 Identities = 103/303 (33%), Positives = 149/303 (49%), Gaps = 27/303 (8%) Query: 31 IVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQTLPTPMRG 90 + R GA + D +GN YID VG +G +GH +P V +AVK+ A++ ++ P Sbjct: 38 VERADGAYLHDVDGNRYIDYVGSWGPMIVGHNHPAVRQAVKKAADSGLSF--GAPCAAEV 95 Query: 91 EFYRTLTAILPPELNRVFPVNSGTEANEAALKFARAHTGRK---KFVAAMRGF------- 140 TLT ++ P V VNSGTEA +A++ AR TGR KF G Sbjct: 96 TMAETLTRLV-PSCEMVRMVNSGTEATLSAIRLARGATGRSRIVKFEGCYHGHGDSFLVK 154 Query: 141 SGRTMGSLSVTWEPKYREPFLPLVEPVEFIPYNDVE---ALKRAVDEETAAVILEPVQGE 197 +G M +L V P L E +PYND + AL A E+ A +I+EPV G Sbjct: 155 AGSGMLTLGVPTSPGVP---AGLSELTLTLPYNDFDAATALFEAQGEQIAGLIIEPVVGN 211 Query: 198 GGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALG 257 P +L+ R + G +LI DE+ TG R A H+G+ PD+ T K +G Sbjct: 212 ANCIPPREGYLQHLRALCTRFGTVLIFDEVMTGF-RVALGGAQAHYGVTPDLTTFGKIIG 270 Query: 258 GGVPLGVAVMREEVARSMPKGG---HGTTFGGNPLAMAAGVAAIRYLER----TRLWERA 310 GG+P+G + E+ + + G T GNP+AMAAG+A + +++ +L RA Sbjct: 271 GGMPVGAYGGKRELMQQISPAGPIYQAGTLSGNPVAMAAGLAMLELVQQPGFHAQLSARA 330 Query: 311 AEL 313 A L Sbjct: 331 ARL 333 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 359 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 426 Length adjustment: 31 Effective length of query: 364 Effective length of database: 395 Effective search space: 143780 Effective search space used: 143780 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory