Align 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; L-2AA aminotransferase; EC 2.6.1.39 (characterized)
to candidate WP_057509166.1 ABB28_RS13775 aspartate aminotransferase family protein
Query= SwissProt::Q88FI7 (416 letters) >NCBI__GCF_001431535.1:WP_057509166.1 Length = 408 Score = 200 bits (509), Expect = 6e-56 Identities = 136/408 (33%), Positives = 207/408 (50%), Gaps = 39/408 (9%) Query: 16 ITLSHGRNAEVWDTDGKRYIDFVGGIGVLNLGHCNPAVVEAIQAQATRLTHYAFNAAPHG 75 + L G+ A VWD+ G+ YID GI V LGH +P + A+ QA +L H + N Sbjct: 24 VVLERGQGARVWDSQGREYIDLAAGIAVCGLGHNDPDLTAALVEQAGKLWHTS-NVFYSA 82 Query: 76 PYLALMEQL---SQFVPVSYPLAGMLTNSGAEAAENALKVARG-------ATGKRAIIAF 125 P L L E+L S+F + L NSGAEA E A+K+ R +R I+ F Sbjct: 83 PPLHLAEELVKASRFAERVF-----LCNSGAEANEVAIKMVRKWASSQGRPADRRVIVTF 137 Query: 126 DGGFHGRTLATLNLNGKVAPYKQRVGELPGPVYHLPYPSADTGVTCEQALKAMDRLFSVE 185 G FHGRTLA + + Y++ LP ++ + + V E A+ Sbjct: 138 RGSFHGRTLAAVTATAQ-PKYQEGYEPLPQGFRYVDF---NDEVQLETAM---------- 183 Query: 186 LAVEDVAAFIFEPVQGEGGFLALDPAFAQALRRFCDERGILIIIDEIQSGFGRTGQRFAF 245 A DVAA + EPVQGEGG + P F + +R CD+ G L+++DEIQ+G GRTG FA Sbjct: 184 -AAGDVAAVMLEPVQGEGGVMPARPGFLKRVRELCDQHGALLVLDEIQAGMGRTGTLFAH 242 Query: 246 PRLGIEPDLLLLAKSIAGGMPLGAVVGRKELMAALPKGGLGGTYSGNPISCAAALASLAQ 305 + G+ PD++ LAK++ GG P+GA++ ++ + G G T+ GNP++ A A +L + Sbjct: 243 WQDGVVPDMVTLAKALGGGFPIGAMLAGPKVAETMQFGAHGTTFGGNPLAAAVARVALRK 302 Query: 306 MTDENLATWGERQEQAIVSRYERWKASGLSPYIGRLTGVGAMRGIEFANADGSPAPAQLA 365 + + +A +RQ +A+ +ER A G++ G G M G + Q Sbjct: 303 LASDEIAANVDRQSRALREGFERINAE--FGVFGQVRGRGLMLGAVLS----KDHLGQAG 356 Query: 366 KVMEAARARGLLLMPSGKARHIIRLLAPLTIEAEVLEEGLDILEQCLA 413 +++ A GLL + +G ++R + L I E + EGL L +A Sbjct: 357 VILDHAAEHGLLTLQAGP--DVLRFVPSLNITDEEIAEGLKRLRAAVA 402 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 404 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 408 Length adjustment: 31 Effective length of query: 385 Effective length of database: 377 Effective search space: 145145 Effective search space used: 145145 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory