Align Homoaconitase large subunit; HACN; Homoaconitate hydratase; EC 4.2.1.36 (characterized)
to candidate WP_057509303.1 ABB28_RS14500 3-isopropylmalate dehydratase large subunit
Query= SwissProt::Q9ZNE0 (418 letters) >NCBI__GCF_001431535.1:WP_057509303.1 Length = 472 Score = 206 bits (525), Expect = 9e-58 Identities = 148/467 (31%), Positives = 223/467 (47%), Gaps = 56/467 (11%) Query: 4 TLAEKILSHKVGRPVRAGELVVVEVDQVMVVDSIAGSFFKRLEYLEATPRYPERVSIVID 63 TL +K+ V P V+ +D ++ + + F L +PR P+R +D Sbjct: 7 TLYDKLWDAHVVVPESDSAPAVLYIDLHLIHEVTSPQAFTELRERGLSPRRPDRTKGTMD 66 Query: 64 HVAPA------ANLEVAKAQKE-----IREWGKRHGIRVFDVG---RGVCHQVLIEEGLA 109 H P +L A A E + +G+ +FD+ RG+ H + E+G Sbjct: 67 HSTPTLPARADGSLPYASAASEAQVAMLASNCAEYGVELFDMASADRGIVHVIAPEQGFT 126 Query: 110 QPGWVVVGSDSHSTTYGAVGAFGTGMGATDIALAAASGRTWLRVPESVKVVFRGRLPKGV 169 PG +V DSH++T+GA G+ G+G +++ A+ R +++ + G LP GV Sbjct: 127 LPGMTIVCGDSHTSTHGAFGSLAFGIGTSEVGHVLATQCLLQRKAKTMAITVDGVLPAGV 186 Query: 170 TAKDAALEMVRLLTAEGATYMAVEIHLLDGAEALTRGERMTLANLTVEAGAKAGLVVPSG 229 AKD L ++ ++ G T +E A A+ +RMTL N+++EAGA+AG+V P Sbjct: 187 GAKDVVLHIIGVIGVNGGTGHVLEFRGSTIA-AMDMEQRMTLCNMSIEAGARAGMVAPDQ 245 Query: 230 EILEMYR--------------VPDW--LYPDPDARYAKEVEIDLSALTPR---------- 263 + V W L D AR+ EV ID + + P Sbjct: 246 VTFDWVAATPRGPKGADFDAAVGRWTQLRSDDGARFDAEVTIDAADIRPTLTWGTHPGTA 305 Query: 264 --VSVPFYVDN------------VHEVAQVKGKRVDQVFIGTCTNGRIEDLRAAAEVLRG 309 V P N +H ++G VD VF+G+CTNGR+ D+R A+VL G Sbjct: 306 IAVDAPIPAANDAAAQKGLDYMQLHAGDTLQGTPVDVVFVGSCTNGRLSDMREVAQVLHG 365 Query: 310 RKVAPWVRLLVVPASSQVLEEAARDGTLLTLLEAGATIGTPGCGPCMGRHMGVLAPGEVC 369 R+VA VR+LVVP S V +A +G + AGA PGC C+ + ++APG++ Sbjct: 366 RQVADRVRMLVVPGSEIVKRQAEAEGIDAIVRAAGAEWREPGCSMCIAMNGDLVAPGQLA 425 Query: 370 VSTSNRNFRGRMGAPDAEIYLASPRVAAASAVAGYLTTPEELEEEEV 416 VSTSNRNF GR G P + LASP AA +AV G ++ +L +EV Sbjct: 426 VSTSNRNFEGRQG-PGSRTLLASPMTAAWAAVNGRVSDTRDLFNQEV 471 Lambda K H 0.318 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 491 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 472 Length adjustment: 32 Effective length of query: 386 Effective length of database: 440 Effective search space: 169840 Effective search space used: 169840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory