Align Methanogen homoaconitase small subunit; HACN; Homoaconitate hydratase; EC 4.2.1.114 (characterized)
to candidate WP_057687523.1 ABB28_RS16850 aconitate hydratase AcnA
Query= SwissProt::Q58667 (170 letters) >NCBI__GCF_001431535.1:WP_057687523.1 Length = 917 Score = 50.1 bits (118), Expect = 1e-10 Identities = 36/125 (28%), Positives = 58/125 (46%), Gaps = 21/125 (16%) Query: 54 VIVAGENFGCGSSREQAVIAIKYCGIKAVIAKSFARIFYRNAINVGLIPIIANTDE---- 109 V++AG+ +G GSSR+ A G+KAVIA+SF RI N + +G++P+ E Sbjct: 791 VVLAGKEYGTGSSRDWAAKGTLLLGVKAVIAESFERIHRSNLVGMGVLPLQFRNGENAQS 850 Query: 110 -------------IKDG--DIVEIDLDKEEIVITNKNKTIKCETPKGLEREILAAGGLVN 154 +KDG + K + + ++ TPK E E GGL+ Sbjct: 851 LGLDGSEVFDITGLKDGASKRATVAAKKADGTVVTFEASVMLLTPK--EVEYFRHGGLLQ 908 Query: 155 YLKKR 159 Y+ ++ Sbjct: 909 YVLRQ 913 Lambda K H 0.318 0.139 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 170 Length of database: 917 Length adjustment: 30 Effective length of query: 140 Effective length of database: 887 Effective search space: 124180 Effective search space used: 124180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory