Align homoserine kinase (EC 2.7.1.39) (characterized)
to candidate WP_057506742.1 ABB28_RS00500 homoserine kinase
Query= reanno::Dyella79:N515DRAFT_0576 (330 letters) >NCBI__GCF_001431535.1:WP_057506742.1 Length = 304 Score = 388 bits (997), Expect = e-113 Identities = 205/302 (67%), Positives = 235/302 (77%) Query: 23 AQALAPASVGNVGIGFDILGHSVAGAGDRARVRRIDEPVVRIAAIEGCVVDLPLDPAQNT 82 A+A APASVGNVG+GFDILGH++AG GD VRRI E VRI AI G V LP + A NT Sbjct: 3 ARAFAPASVGNVGVGFDILGHAIAGVGDTVTVRRIAEREVRIEAIRGADVPLPREAALNT 62 Query: 83 AGMALMALRKALGLRHGFELVLHKGIALGSGMGGSASSCVAALVAANALLERPLPMESLY 142 AG +L+ALR+AL L GF + + KGI LGSGMGGSA+SCVAALVAANALL+ L +LY Sbjct: 63 AGASLLALRQALDLPFGFAVEIDKGIPLGSGMGGSAASCVAALVAANALLDSALDRHALY 122 Query: 143 GFALEGEAVASGGRHGDNVGPMLLGGLVLATRDRLVRVPVPDAWHCALVHPHMVLETRKA 202 FALEGE VASGGRHGDN+GPMLLGGLVL+T DRLV +PVP WH LVHP VLETR+A Sbjct: 123 RFALEGELVASGGRHGDNLGPMLLGGLVLSTADRLVPIPVPARWHSLLVHPDAVLETRRA 182 Query: 203 RAALAGAYQLGEFVAQSANLSLMLAGCWQGDAGLVREGLNDVLVEPRRAPLIPGFARVKQ 262 RAAL G+Y LG+FVAQSANL+L+LAGC QGDA LVR GL DVLVEPRRAPLI GF + Sbjct: 183 RAALQGSYALGDFVAQSANLALVLAGCHQGDATLVRAGLRDVLVEPRRAPLIIGFDAARA 242 Query: 263 AAMDHRAMGASISGAGPSVFGWFEQRDEAKAAAAAMAAAFAEAGLDSDTLVSPIAGPSAA 322 AA+ AMGASISGAGPSVF WFE + A+AAAA + AAFA +G DS VS +A P+A Sbjct: 243 AALAAGAMGASISGAGPSVFAWFEDQASAQAAAAPVQAAFAASGFDSQAWVSSLAAPAAV 302 Query: 323 LI 324 L+ Sbjct: 303 LL 304 Lambda K H 0.320 0.134 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 337 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 304 Length adjustment: 27 Effective length of query: 303 Effective length of database: 277 Effective search space: 83931 Effective search space used: 83931 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_057506742.1 ABB28_RS00500 (homoserine kinase)
to HMM TIGR00191 (thrB: homoserine kinase (EC 2.7.1.39))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00191.hmm # target sequence database: /tmp/gapView.30551.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00191 [M=304] Accession: TIGR00191 Description: thrB: homoserine kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-54 171.1 0.0 1.7e-54 170.7 0.0 1.0 1 lcl|NCBI__GCF_001431535.1:WP_057506742.1 ABB28_RS00500 homoserine kinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001431535.1:WP_057506742.1 ABB28_RS00500 homoserine kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 170.7 0.0 1.7e-54 1.7e-54 5 275 .. 7 276 .. 4 291 .. 0.87 Alignments for each domain: == domain 1 score: 170.7 bits; conditional E-value: 1.7e-54 TIGR00191 5 vPassANlgpGfDvlGlalslvlellvtedvaqeskdksleaegegvekipkesdkNliyqvakkvlkk 73 +Pas N+g+GfD+lG a+ v + + + +++ ++++e+ + +p+ ++ l + a ++ + lcl|NCBI__GCF_001431535.1:WP_057506742.1 7 APASVGNVGVGFDILGHAIAGVGDTVTVR----RIAEREVRIEAIRGADVPLPREAALNTAGASLLALR 71 8******************9998776666....455555666666666677666666666555555444 PP TIGR00191 74 lgkr.vkpvkltvekeiplgrGLGSSaaaivaaviaanelaglklskeelldlalllEg......HpDN 135 + + + +++++++k iplg+G+G Saa+ vaa++aan+l++ l+++ l +al+ E H DN lcl|NCBI__GCF_001431535.1:WP_057506742.1 72 QALDlPFGFAVEIDKGIPLGSGMGGSAASCVAALVAANALLDSALDRHALYRFALEGELvasggrHGDN 140 4444469***************************************************9********** PP TIGR00191 136 vapallGGlqlavkeddllevlkvPsgsklkvvlviPnievsTaeaRavLPkaysrqdlvfnlshlavl 204 +p llGGl+l++ + + ++vP ++++ +lv P + T+ aRa L +y + d v+++++la++ lcl|NCBI__GCF_001431535.1:WP_057506742.1 141 LGPMLLGGLVLSTADRL--VPIPVP--ARWHSLLVHPDAVLETRRARAALQGSYALGDFVAQSANLALV 205 **********9998777..566666..9***************************************** PP TIGR00191 205 vtAlvskdkadllaiamkDrvhqpyRekliPelteikqaakekgalgitlSGaGptilalaeeek.eek 272 + ++++ a l++ ++D++ +p R+ li ++++ + aa ++ga+g +SGaGp+++a e++ ++ lcl|NCBI__GCF_001431535.1:WP_057506742.1 206 LAGCHQG-DATLVRAGLRDVLVEPRRAPLIIGFDAARAAALAAGAMGASISGAGPSVFAWFEDQAsAQA 273 *******.899************************************************9999985555 PP TIGR00191 273 aqe 275 a+ lcl|NCBI__GCF_001431535.1:WP_057506742.1 274 AAA 276 554 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (304 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.77 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory