Align L-serine/homoserine O-acetyltransferase; Homoserine O-trans-acetylase; EC 2.3.1.30; EC 2.3.1.31 (characterized)
to candidate WP_057687234.1 ABB28_RS15260 homoserine O-acetyltransferase
Query= SwissProt::D2Z028 (374 letters) >NCBI__GCF_001431535.1:WP_057687234.1 Length = 370 Score = 471 bits (1213), Expect = e-137 Identities = 235/370 (63%), Positives = 281/370 (75%), Gaps = 3/370 (0%) Query: 1 MREFIPPASRFIELPDGFAMRRGGALYGARIAYETFGSLNAARDNAVLVLTGLSPDAHAA 60 M EFIPP + F LP F +RGGAL R+AYET+G+L+A NA+L++TGLSPDAHAA Sbjct: 1 MTEFIPPGTLFHALPSPFPFKRGGALTAGRVAYETWGTLDADAGNAILIVTGLSPDAHAA 60 Query: 61 SRPDDPTPGWWEAMVGPGKPVDTDLWHVICVNSLGSCKGSTGPASTDPRTGEPYRLSFPE 120 S +P GWWE MVGPGKP+DTD W VICVNSLGSCKGSTGPAS D TG+PYRLSFPE Sbjct: 61 SNAANPATGWWEGMVGPGKPIDTDRWFVICVNSLGSCKGSTGPASIDAATGKPYRLSFPE 120 Query: 121 LSIEDIADAAAHTVRALGISRLACVVGASMGGMSALALLARHPELARTHISLSGAVHALP 180 LS+ED A A+ VRALGI++LAC+VG SMGGM+ALALL HP +AR+HI++SG+ ALP Sbjct: 121 LSVEDGARASVEVVRALGITQLACLVGNSMGGMTALALLLLHPGIARSHINISGSAQALP 180 Query: 181 FSIAVRSLQREAIRSDPGWLQGHYDEGEGPRRGMLTARKLGMMTYRSAQEWDCRFGRTRI 240 FSIA+RSLQREAIR DP W G YD+ P GM ARKLG++TYRSA EWD RFGR R+ Sbjct: 181 FSIAIRSLQREAIRLDPQWNGGQYDDANYPESGMRMARKLGVITYRSALEWDGRFGRVRL 240 Query: 241 GERRRADQGRFGPEFEVESYLDFHAQRFADRFDPNSYLYLSHAMDQFDLGDGGGGGGGAP 300 + +AD FG EF+VESYL+ HA+RF FDPN YLYLS +MD FDL + G G Sbjct: 241 -DSDQADDDPFGLEFQVESYLEGHARRFVRFFDPNCYLYLSRSMDWFDLAE--HGNGDVM 297 Query: 301 GALSRMRVERALVMGARTDILFPLSQQQEIADGLSAGGADVSFLPVDTPAGHDAFLVDIE 360 L+ ++VE+AL +GA TDILFP+ QQQ+IADGL AGGA+ F+ +D+P GHDAFLVD E Sbjct: 298 AGLATIKVEKALAIGANTDILFPVQQQQQIADGLRAGGAEAHFIGLDSPQGHDAFLVDFE 357 Query: 361 RFGPPVAKFL 370 RFGP V FL Sbjct: 358 RFGPAVRGFL 367 Lambda K H 0.321 0.138 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 498 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 370 Length adjustment: 30 Effective length of query: 344 Effective length of database: 340 Effective search space: 116960 Effective search space used: 116960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_057687234.1 ABB28_RS15260 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.14093.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-113 364.4 0.0 3.8e-113 364.1 0.0 1.0 1 lcl|NCBI__GCF_001431535.1:WP_057687234.1 ABB28_RS15260 homoserine O-acety Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001431535.1:WP_057687234.1 ABB28_RS15260 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 364.1 0.0 3.8e-113 3.8e-113 4 350 .. 17 367 .. 15 368 .. 0.96 Alignments for each domain: == domain 1 score: 364.1 bits; conditional E-value: 3.8e-113 TIGR01392 4 eltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedkGWWdellGpgraldtsr 72 ++ ++ G+ l+ +vay+t+Gtl a+ Na+l++ l+ +ah+a++a + ++GWW+ ++Gpg+++dt+r lcl|NCBI__GCF_001431535.1:WP_057687234.1 17 PFPFKRGGALTAGRVAYETWGTLDADAGNAILIVTGLSPDAHAASNAANPATGWWEGMVGPGKPIDTDR 85 78899***************************************99999999***************** PP TIGR01392 73 yfvvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgSlGGmq 141 +fv+c+N+lGsckGstgP+si+ +tgkpy+ +fP ++++D ++a+ +++++Lg+++la+ vG S+GGm+ lcl|NCBI__GCF_001431535.1:WP_057687234.1 86 WFVICVNSLGSCKGSTGPASIDAATGKPYRLSFPELSVEDGARASVEVVRALGITQLACLVGNSMGGMT 154 ********************************************************************* PP TIGR01392 142 alewalsypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeeeqPekGLalARmlall 210 al + l p ++++ ++++ sa+a + ia++++qr+ai+ Dp++n+G+y++ + Pe+G+++AR+l+ + lcl|NCBI__GCF_001431535.1:WP_057687234.1 155 ALALLLLHPGIARSHINISGSAQALPFSIAIRSLQREAIRLDPQWNGGQYDDANYPESGMRMARKLGVI 223 ********************************************************************* PP TIGR01392 211 tYrseesleerfgreakseeslass.leeefsvesylryqgkkfverFdAnsYllltkaldthdlargr 278 tYrs + + rfgr + ++++ + + ef+vesyl+ ++++fv+ Fd n+Yl+l++++d +dla+ lcl|NCBI__GCF_001431535.1:WP_057687234.1 224 TYRSALEWDGRFGRVRLDSDQADDDpFGLEFQVESYLEGHARRFVRFFDPNCYLYLSRSMDWFDLAEHG 292 *************98777655544327****************************************99 PP TIGR01392 279 rdslkealkkikap.vlvvgiesDllftleeqeelakalkaakle..yaeieseeGHDaFllekekvee 344 ++++++ l++ik++ +l +g ++D+lf++++q+++a+ l+a ++e + ++s++GHDaFl+++e++ lcl|NCBI__GCF_001431535.1:WP_057687234.1 293 NGDVMAGLATIKVEkALAIGANTDILFPVQQQQQIADGLRAGGAEahFIGLDSPQGHDAFLVDFERFGP 361 ************986899**********************998888899******************** PP TIGR01392 345 lirefl 350 ++r fl lcl|NCBI__GCF_001431535.1:WP_057687234.1 362 AVRGFL 367 **9997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (370 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.87 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory