Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate WP_057506775.1 ABB28_RS00665 chorismate mutase
Query= SwissProt::P27603 (365 letters) >NCBI__GCF_001431535.1:WP_057506775.1 Length = 398 Score = 330 bits (847), Expect = 3e-95 Identities = 173/360 (48%), Positives = 242/360 (67%), Gaps = 7/360 (1%) Query: 7 LKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAV-FYRPEREAWVLKHIM 65 L +R +ID +D I LI+ERAR A +V + K K AV +YRPEREA VL+ ++ Sbjct: 43 LADVRGKIDQIDRDIQSLIAERARFAHQVGKAKG----KLAAAVDYYRPEREAQVLRMVV 98 Query: 66 ELNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVISKPMA 125 + N+GPL +E + ++REIMS+CLA ++PL++ YLGPEGTFSQ A LKHFG S + PMA Sbjct: 99 DRNEGPLSDELLVHVYREIMSACLAQQEPLKIGYLGPEGTFSQQAVLKHFGRSALGLPMA 158 Query: 126 AIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLVGET 185 +I+EVF+EV AG +FGVVPVENS +G + TLD FL ++ ICGE ELR+ +++ + Sbjct: 159 SIEEVFQEVEAGNADFGVVPVENSGQGTIQITLDMFLTSNLKICGEAELRVQQYIM-SRS 217 Query: 186 TKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDMAA 245 + I RIY+H QS Q WL A+ P E++ VSSNA+ A+R ++ ++AAI G+ A Sbjct: 218 GHLEDIERIYAHPQSFMQTSAWLRANLPKAEKIPVSSNAEGARRARNADDAAAIGGENAG 277 Query: 246 QLYGLSKLAEK-IEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELLMPFH 304 +Y L K+ K I++ N+TRFL+IG P +G D+TS++V + +KPGAL ++L PF Sbjct: 278 HVYNLKKVVTKPIQNDADNTTRFLVIGRSLFPSSGHDRTSVLVLIHDKPGALFDVLSPFA 337 Query: 305 SNGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSYPKAV 364 +GI + RIE+RPS GKW Y FFID GH D ++ L ++ A +KVLGSYP AV Sbjct: 338 RHGISMNRIESRPSHHGKWEYGFFIDLSGHIDDAPMQAALAELEGHAAQIKVLGSYPVAV 397 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 385 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 398 Length adjustment: 30 Effective length of query: 335 Effective length of database: 368 Effective search space: 123280 Effective search space used: 123280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory