Align Ornithine aminotransferase; Orn-AT; Lysine aminotransferase; Lys-AT; EC 2.6.1.13; EC 2.6.1.36 (characterized)
to candidate WP_057509163.1 ABB28_RS13760 glutamate-1-semialdehyde-2,1-aminomutase
Query= SwissProt::Q5JEW1 (445 letters) >NCBI__GCF_001431535.1:WP_057509163.1 Length = 426 Score = 134 bits (338), Expect = 4e-36 Identities = 99/315 (31%), Positives = 147/315 (46%), Gaps = 29/315 (9%) Query: 37 PIVIERGEGIRVYDVDGNVFYDFASGVGVINVGHSHPRVVEAIKKQAEKFTHYSLTDFFY 96 P +ER +G ++DVDGN + D+ G + VGH+HP V +A+KK A+ + Sbjct: 35 PFFVERADGAYLHDVDGNRYIDYVGSWGPMIVGHNHPAVRQAVKKAADSGLSFGAP---C 91 Query: 97 ENAIILAEKLIELAPG-DIERKVVYGNSGAEANEAAMKLVKYGTGRKQFLAFYHAFHGRT 155 + +AE L L P ++ R V NSG EA +A++L + TGR + + F +HG Sbjct: 92 AAEVTMAETLTRLVPSCEMVRMV---NSGTEATLSAIRLARGATGRSRIVKFEGCYHGHG 148 Query: 156 QAVLSLTASKWVQQDGFFPTMPGVTHIPYPNPYRNTWGIDGYEEPDELTNRVLDFIEEYV 215 + L S + PT PGV G E LT DF Sbjct: 149 DSFLVKAGSGMLTLG--VPTSPGVP--------------AGLSEL-TLTLPYNDFDAATA 191 Query: 216 FRHVPPHEIGAIFFEPIQGEGGYVVPPKGFFKALKKFADEYGILLADDEVQMGIGRTGKF 275 +I + EP+ G + P +G+ + L+ +G +L DEV G R Sbjct: 192 LFEAQGEQIAGLIIEPVVGNANCIPPREGYLQHLRALCTRFGTVLIFDEVMTGF-RVALG 250 Query: 276 WAIEHFGVEPDLIQFGKAIGGGLPLAGVIHRAD----ITFDKPGRHATTFGGNPVAIAAG 331 A H+GV PDL FGK IGGG+P+ + + I+ P A T GNPVA+AAG Sbjct: 251 GAQAHYGVTPDLTTFGKIIGGGMPVGAYGGKRELMQQISPAGPIYQAGTLSGNPVAMAAG 310 Query: 332 IEVVEIVKELLPHVQ 346 + ++E+V++ H Q Sbjct: 311 LAMLELVQQPGFHAQ 325 Lambda K H 0.320 0.141 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 455 Number of extensions: 31 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 426 Length adjustment: 32 Effective length of query: 413 Effective length of database: 394 Effective search space: 162722 Effective search space used: 162722 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory