Align Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase; EC 2.6.1.118; EC 2.6.1.124 (uncharacterized)
to candidate WP_057509163.1 ABB28_RS13760 glutamate-1-semialdehyde-2,1-aminomutase
Query= curated2:Q5JFW3 (362 letters) >NCBI__GCF_001431535.1:WP_057509163.1 Length = 426 Score = 124 bits (312), Expect = 4e-33 Identities = 97/285 (34%), Positives = 133/285 (46%), Gaps = 26/285 (9%) Query: 12 RGEGVYVWDEKGRRYLDLIAGIGVNVLGHAHPEWVLDMSRQLEKIVVAGPMFEHDEREE- 70 R +G Y+ D G RY+D + G ++GH HP + + ++K +G F E Sbjct: 40 RADGAYLHDVDGNRYIDYVGSWGPMIVGHNHPA----VRQAVKKAADSGLSFGAPCAAEV 95 Query: 71 -MLEELSHWV-DYEYVYMGNSGTEAVEAAIKFARLATGRSEIVAMTNAFHGRTLGSLSAT 128 M E L+ V E V M NSGTEA +AI+ AR ATGRS IV +HG L Sbjct: 96 TMAETLTRLVPSCEMVRMVNSGTEATLSAIRLARGATGRSRIVKFEGCYHGHGDSFLVKA 155 Query: 129 WKKKYREGFGPLVPGFKH--------IPFNNVEAAK---EAITKETAAVIFEPIQGEGGI 177 G P PG +P+N+ +AA EA ++ A +I EP+ G Sbjct: 156 GSGMLTLGV-PTSPGVPAGLSELTLTLPYNDFDAATALFEAQGEQIAGLIIEPVVGNANC 214 Query: 178 VPADEEFVKTLRDLTEDVGALLIADEVQSGLRTGKFLAIEHYGVRPDIVTMGKGIGNGFP 237 +P E +++ LR L G +LI DEV +G R A HYGV PD+ T GK IG G P Sbjct: 215 IPPREGYLQHLRALCTRFGTVLIFDEVMTGFRVALGGAQAHYGVTPDLTTFGKIIGGGMP 274 Query: 238 VSLTLTDLEI-----PRGK--HGSTFGGNPLACRAVATTLRILRR 275 V E+ P G T GNP+A A L ++++ Sbjct: 275 VGAYGGKRELMQQISPAGPIYQAGTLSGNPVAMAAGLAMLELVQQ 319 Lambda K H 0.320 0.140 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 28 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 426 Length adjustment: 31 Effective length of query: 331 Effective length of database: 395 Effective search space: 130745 Effective search space used: 130745 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory