Align [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase; EC 2.6.1.118; EC 2.6.1.124 (uncharacterized)
to candidate WP_057509166.1 ABB28_RS13775 aspartate aminotransferase family protein
Query= curated2:Q7SI94 (388 letters) >NCBI__GCF_001431535.1:WP_057509166.1 Length = 408 Score = 231 bits (588), Expect = 4e-65 Identities = 131/380 (34%), Positives = 220/380 (57%), Gaps = 22/380 (5%) Query: 5 LKFYQDRGIKIIKGEGQYVWDEKNNKYLDMHAGHGVAFLGHRNKVIIDHLKKQMEEI-ST 63 L Y+ R + + +G+G VWD + +Y+D+ AG V LGH + + L +Q ++ T Sbjct: 16 LPVYKPRQVVLERGQGARVWDSQGREYIDLAAGIAVCGLGHNDPDLTAALVEQAGKLWHT 75 Query: 64 LSLAFDTP---IREEMIKELDELKPEDLDNLFLLNSGSEAVELALKIARKITK------- 113 ++ + P + EE++K + +FL NSG+EA E+A+K+ RK Sbjct: 76 SNVFYSAPPLHLAEELVKA-----SRFAERVFLCNSGAEANEVAIKMVRKWASSQGRPAD 130 Query: 114 RRKIVAFKNSFHGRSMGALSVTWNKKYREPFEPLIGPVEFLEYNNVDSLKSITE--DTAA 171 RR IV F+ SFHGR++ A++ T KY+E +EPL ++++N+ L++ D AA Sbjct: 131 RRVIVTFRGSFHGRTLAAVTATAQPKYQEGYEPLPQGFRYVDFNDEVQLETAMAAGDVAA 190 Query: 172 VIVEPVQGEGGVIPAKKEFVKSLREVTEKVNALLIIDEVQTGFGRTGKIWAYQHFDIKPD 231 V++EPVQGEGGV+PA+ F+K +RE+ ++ ALL++DE+Q G GRTG ++A+ + PD Sbjct: 191 VMLEPVQGEGGVMPARPGFLKRVRELCDQHGALLVLDEIQAGMGRTGTLFAHWQDGVVPD 250 Query: 232 ILTAGKAIGGGFPVSAVFLPNWISEKIEEGDHGSTYGGNPLAAAAVTAACKVAKSEKIAE 291 ++T KA+GGGFP+ A+ ++E ++ G HG+T+GGNPLAAA A + S++IA Sbjct: 251 MVTLAKALGGGFPIGAMLAGPKVAETMQFGAHGTTFGGNPLAAAVARVALRKLASDEIAA 310 Query: 292 QAQKKGELFMRILKEKLEDFKIVREIRGLGLMIGIDLKVN----PSIAIKVLQDEKVLSL 347 ++ + +F + ++RG GLM+G L + + + + +L+L Sbjct: 311 NVDRQSRALREGFERINAEFGVFGQVRGRGLMLGAVLSKDHLGQAGVILDHAAEHGLLTL 370 Query: 348 KAGLTTIRFLPPYLITQSDM 367 +AG +RF+P IT ++ Sbjct: 371 QAGPDVLRFVPSLNITDEEI 390 Lambda K H 0.317 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 353 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 408 Length adjustment: 31 Effective length of query: 357 Effective length of database: 377 Effective search space: 134589 Effective search space used: 134589 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory