Align Pyrroline-5-carboxylate reductase; P5C reductase; P5CR; PCA reductase; EC 1.5.1.2 (characterized)
to candidate WP_057506907.1 ABB28_RS01365 pyrroline-5-carboxylate reductase
Query= SwissProt::P22008 (273 letters) >NCBI__GCF_001431535.1:WP_057506907.1 Length = 273 Score = 256 bits (655), Expect = 3e-73 Identities = 149/271 (54%), Positives = 181/271 (66%), Gaps = 5/271 (1%) Query: 1 MSTPRIAFIGAGNMAASLIGGLRAQGVPAAQIRASDPGAEQRAKIAGEFAIDVVESNAEA 60 M+ IAFIG GNMA SLI GL QG PAA I ++P A R +A +F + + +EA Sbjct: 1 MTDSSIAFIGGGNMARSLIAGLVRQGTPAADIHVAEPVAALRDALAADFGVSPHATASEA 60 Query: 61 VADADVVVLSVKPQAMKAVC---QALAPALKPEQLIVSIAAGIPCASLEAWLGQPRPVVR 117 A A +L+VKPQ ++ VC ALA A +P L+VSIAAGI A L+ WLG VVR Sbjct: 61 AAQAGAWLLAVKPQVLREVCATLHALATAKRP--LLVSIAAGITSAQLDRWLGGNIAVVR 118 Query: 118 CMPNTPALLRQGASGLYANAQVSAAQCEQAGQLLSAVGIALWLDDEAQIDAVTAVSGSGP 177 MPNTPALL G +GLYA AQV+AAQ QA ++LS+ G +W+DDEA +D+VTAVSGSGP Sbjct: 119 AMPNTPALLGAGVTGLYATAQVTAAQRAQADRVLSSAGRTVWVDDEALMDSVTAVSGSGP 178 Query: 178 AYFFLLMQAMTDAGEKLGLSRETASRLTLQTALGAAQMALSSEVEPAELRRRVTSPNGTT 237 AY FLL +AM AG GL E A L QT LGA++M + PAELRRRVTSP GTT Sbjct: 179 AYVFLLAEAMEAAGIAQGLPPEAARTLVQQTLLGASRMLDEAGEAPAELRRRVTSPGGTT 238 Query: 238 EAAIKSFQANGFEALVEQALNAASQRSAELA 268 AAI++FQA GFE LV +AL AA R EL+ Sbjct: 239 HAAIEAFQAGGFEPLVAKALAAAQARGRELS 269 Lambda K H 0.315 0.127 0.348 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 273 Length adjustment: 25 Effective length of query: 248 Effective length of database: 248 Effective search space: 61504 Effective search space used: 61504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
Align candidate WP_057506907.1 ABB28_RS01365 (pyrroline-5-carboxylate reductase)
to HMM TIGR00112 (proC: pyrroline-5-carboxylate reductase (EC 1.5.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00112.hmm # target sequence database: /tmp/gapView.10387.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00112 [M=263] Accession: TIGR00112 Description: proC: pyrroline-5-carboxylate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-86 276.7 6.9 1.3e-86 276.5 6.9 1.0 1 lcl|NCBI__GCF_001431535.1:WP_057506907.1 ABB28_RS01365 pyrroline-5-carbox Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001431535.1:WP_057506907.1 ABB28_RS01365 pyrroline-5-carboxylate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 276.5 6.9 1.3e-86 1.3e-86 1 263 [] 6 268 .. 6 268 .. 0.99 Alignments for each domain: == domain 1 score: 276.5 bits; conditional E-value: 1.3e-86 TIGR00112 1 iaiiGaGnmgeallsgllkkgakakkeilvierseeklaalakelgvevtsdaeeavkeadvvllavKP 69 ia+iG+Gnm+++l++gl+++g++ +++i+v+e+ ++ ++ala+++gv+ +++a ea+++a +llavKP lcl|NCBI__GCF_001431535.1:WP_057506907.1 6 IAFIGGGNMARSLIAGLVRQGTP-AADIHVAEPVAALRDALAADFGVSPHATASEAAAQAGAWLLAVKP 73 89******************998.8******************************************** PP TIGR00112 70 qdleevlaelkseektkeklliSilAGvtiekleqlleaekrvvRvmPNtaakvgagvtaiaassevse 138 q+l+ev+a+l+ ++k ll+Si+AG+t ++l ++l+++ +vvR+mPNt+a +gagvt+++a+++v++ lcl|NCBI__GCF_001431535.1:WP_057506907.1 74 QVLREVCATLHALATAKRPLLVSIAAGITSAQLDRWLGGNIAVVRAMPNTPALLGAGVTGLYATAQVTA 142 ************9999***************************************************** PP TIGR00112 139 eqkelveellkavGkvveve.eklldavtalsGSgPAfvflliealadagvklGLpreeakelaaqtlk 206 +q+++++++l++ G +v+v+ e+l+d vta+sGSgPA+vfll+ea+++ag+++GLp e a++l++qtl lcl|NCBI__GCF_001431535.1:WP_057506907.1 143 AQRAQADRVLSSAGRTVWVDdEALMDSVTAVSGSGPAYVFLLAEAMEAAGIAQGLPPEAARTLVQQTLL 211 ********************************************************************* PP TIGR00112 207 GaaklleesgehpalLkdkVtsPgGtTiaglavLeekgvrsavieaveaavkrseeL 263 Ga+++l e ge pa+L+ +VtsPgGtT+a++++++++g++ v++a+ aa +r +eL lcl|NCBI__GCF_001431535.1:WP_057506907.1 212 GASRMLDEAGEAPAELRRRVTSPGGTTHAAIEAFQAGGFEPLVAKALAAAQARGREL 268 *****************************************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (273 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.84 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory