Align aspartate-prephenate aminotransferase (EC 2.6.1.78) (characterized)
to candidate WP_057506846.1 ABB28_RS01035 pyridoxal phosphate-dependent aminotransferase
Query= BRENDA::Q56232 (385 letters) >NCBI__GCF_001431535.1:WP_057506846.1 Length = 382 Score = 184 bits (468), Expect = 3e-51 Identities = 124/359 (34%), Positives = 183/359 (50%), Gaps = 15/359 (4%) Query: 34 VALTAGEPDFDTPEHVKEAARRALAQGKTKYAPPAGIPELREALAEKFRRENGLSVTPE- 92 V L G PDF P+ + +A A+A G +Y P G+ LR+A+A+K G V P+ Sbjct: 28 VNLGQGFPDFSAPQRLIDATTAAMADGLNQYPPMTGVAPLRQAIAQKSLDLYGAQVDPDT 87 Query: 93 ETIVTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVP 152 E VT G +A+FN A++ G+EVIVL P + Y + AG V V P+ F Sbjct: 88 EITVTSGATEAIFNAIHAVVRAGEEVIVLDPAYDCYEPAIDLAGARAVHVPLDPQT-FAV 146 Query: 153 DPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYE 212 D +RVR AITPRT+ L+VN+P+NP+GA+ + L+ALA L D YL+SDE+YEH++Y+ Sbjct: 147 DWDRVRAAITPRTRLLMVNTPHNPSGAMLAEADLQALADLLRGTDIYLISDEVYEHIIYD 206 Query: 213 GEHFSPGRVAPE---HTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDT 269 G PE ++ K + TGW+IGYA P + V +T + Sbjct: 207 GRRHESALRHPELRARAFVISSFGKTYHCTGWKIGYAIAPPALSAEFRKVHQYNTFTSFG 266 Query: 270 IAQWATLEALTNQEASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDTSP 329 AQ+ A ++ + +E+ Y+ +RD E L L + G ++ L+D S Sbjct: 267 PAQYGF--AAMIRDEPQHHLELG-AFYQAKRDRFREQLAQTRLVPLAVPGGYFQLVDYSA 323 Query: 330 IA--PDEVRAAERLLEAGVAVVPGTDF-----AAFGHVRLSYATSEENLRKALERFARV 381 I+ PD +E GVA +P + F VRL +A +E L A+ER R+ Sbjct: 324 ISDLPDHEFVKWLTIEKGVAAIPLSPFYEAPPVGQRIVRLCFAKNEATLDAAIERLQRL 382 Lambda K H 0.317 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 351 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 382 Length adjustment: 30 Effective length of query: 355 Effective length of database: 352 Effective search space: 124960 Effective search space used: 124960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory