Align 3-dehydroquinate synthase (EC 4.2.3.4) (characterized)
to candidate WP_058932360.1 AU252_RS20930 3-dehydroquinate synthase
Query= BRENDA::P9WPX9 (362 letters) >NCBI__GCF_001484605.1:WP_058932360.1 Length = 363 Score = 411 bits (1056), Expect = e-119 Identities = 214/345 (62%), Positives = 252/345 (73%), Gaps = 1/345 (0%) Query: 18 YPVVIGTGLLDELEDLLADR-HKVAVVHQPGLAETAEEIRKRLAGKGVDAHRIEIPDAEA 76 Y VV+G GLL L LL +R +V V+H L T + +R LA G + EIPDAE Sbjct: 19 YDVVVGRGLLGNLPALLGERVRRVLVIHPRALRLTGDTVRDELAAAGFTSLTAEIPDAEE 78 Query: 77 GKDLPVVGFIWEVLGRIGIGRKDALVSLGGGAATDVAGFAAATWLRGVSIVHLPTTLLGM 136 GK + V F W+VLG+ R DA+V++GGGA TD+AGF AATWLRGV ++H+PT+LLGM Sbjct: 79 GKHIQVAAFCWQVLGQNDFTRSDAIVAVGGGAVTDLAGFVAATWLRGVKVIHMPTSLLGM 138 Query: 137 VDAAVGGKTGINTDAGKNLVGAFHQPLAVLVDLATLQTLPRDEMICGMAEVVKAGFIADP 196 VDA+VGGKTGINT GKNLVG+FH P VLVDL TL TLPR+E+I GMAEV+K GFIADP Sbjct: 139 VDASVGGKTGINTAEGKNLVGSFHPPAGVLVDLDTLNTLPRNEIISGMAEVIKCGFIADP 198 Query: 197 VILDLIEADPQAALDPAGDVLPELIRRAITVKAEVVAADEKESELREILNYGHTLGHAIE 256 ILDL+E DP AA DP D L ELI RAI VKA+VV+ D KES LREILNYGHTL HAIE Sbjct: 199 AILDLVEKDPAAATDPGSDALRELIERAIAVKAKVVSEDLKESGLREILNYGHTLAHAIE 258 Query: 257 RRERYRWRHGAAVSVGLVFAAELARLAGRLDDATAQRHRTILSSLGLPVSYDPDALPQLL 316 ERY WRHGAAVSVG++FAAELAR GRL DA A RHR+IL +LGLPV+Y D LL Sbjct: 259 LVERYSWRHGAAVSVGMMFAAELARSVGRLSDADADRHRSILETLGLPVTYRRDRWQGLL 318 Query: 317 EIMAGDKKTRAGVLRFVVLDGLAKPGRMVGPDPGLLVTAYAGVCA 361 + M DKK+R +LRFVVLDG+AKPG + PD LL AY + + Sbjct: 319 DGMRRDKKSRGDLLRFVVLDGIAKPGILDVPDTSLLFAAYQEIAS 363 Lambda K H 0.320 0.139 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 469 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 363 Length adjustment: 29 Effective length of query: 333 Effective length of database: 334 Effective search space: 111222 Effective search space used: 111222 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_058932360.1 AU252_RS20930 (3-dehydroquinate synthase)
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.23923.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-112 361.4 0.0 3e-112 361.2 0.0 1.0 1 lcl|NCBI__GCF_001484605.1:WP_058932360.1 AU252_RS20930 3-dehydroquinate s Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001484605.1:WP_058932360.1 AU252_RS20930 3-dehydroquinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 361.2 0.0 3e-112 3e-112 1 334 [. 19 348 .. 19 356 .. 0.96 Alignments for each domain: == domain 1 score: 361.2 bits; conditional E-value: 3e-112 TIGR01357 1 ykvkvgegllkklveelaekasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKsletva 69 y+v+vg+gll +l + l e+ + v++++ ++ +l ++++++ l+++g++ l++ +pd+ee K+++++a lcl|NCBI__GCF_001484605.1:WP_058932360.1 19 YDVVVGRGLLGNLPALLGER-VRRVLVIHPRALRLTGDTVRDELAAAGFTSLTAEIPDAEEGKHIQVAA 86 7899*******999999985.56677888999999********************************** PP TIGR01357 70 klldqlleeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlplgk 138 +++ l +++++r++++va+GGG+v+DlaGFvAat+lRG++++++PT+ll+mvD+svGGKtgin+++gk lcl|NCBI__GCF_001484605.1:WP_058932360.1 87 FCWQVLGQNDFTRSDAIVAVGGGAVTDLAGFVAATWLRGVKVIHMPTSLLGMVDASVGGKTGINTAEGK 155 ********************************************************************* PP TIGR01357 139 NliGafyqPkaVlidlkvletlperelreGmaEviKhgliadaelfeelekneklllklaelealeeli 207 Nl+G+f+ P Vl+dl++l+tlp++e+++GmaEviK g+iad ++++ +ek ++ ++ +al+eli lcl|NCBI__GCF_001484605.1:WP_058932360.1 156 NLVGSFHPPAGVLVDLDTLNTLPRNEIISGMAEVIKCGFIADPAILDLVEKDPAAATDP-GSDALRELI 223 ***************************************************99988875.66******* PP TIGR01357 208 krsievKaevVeeDekesglRalLNfGHtlgHaiEallkyklsHGeaVaiGmvveaklseklgllkael 276 +r+i vKa+vV+eD kesglR++LN+GHtl+HaiE + y+++HG aV++Gm+++a+l++++g l+ + lcl|NCBI__GCF_001484605.1:WP_058932360.1 224 ERAIAVKAKVVSEDLKESGLREILNYGHTLAHAIELVERYSWRHGAAVSVGMMFAAELARSVGRLSDAD 292 ********************************************************************* PP TIGR01357 277 lerlvallkklglptklkkklsveellkallkDKKnegskiklvlleeiGkaalasev 334 ++r++++l++lglp+++++ + + ll+ + +DKK++g+ +++v+l+ i+k+ + +v lcl|NCBI__GCF_001484605.1:WP_058932360.1 293 ADRHRSILETLGLPVTYRR-DRWQGLLDGMRRDKKSRGDLLRFVVLDGIAKPGIL-DV 348 ******************8.999**************************998776.55 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (363 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.87 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory