Align Phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate WP_058932129.1 AU252_RS19525 D-2-hydroxyacid dehydrogenase
Query= reanno::SB2B:6938941 (308 letters) >NCBI__GCF_001484605.1:WP_058932129.1 Length = 354 Score = 131 bits (329), Expect = 3e-35 Identities = 90/254 (35%), Positives = 128/254 (50%), Gaps = 11/254 (4%) Query: 60 LRWMQSTFAGVDLLVKP-----RQRRDYLLTNVRGIFGPLMSEYL-FGYLLARQREHDLY 113 L+W+ + AG VK + +T G+ ++E+ G L +R +L Sbjct: 97 LQWVHAMAAGAGGAVKASGLDQETLLKFKVTTSAGVHALPLAEFAALGILNGFKRSAELA 156 Query: 114 KSQQQQKLW--LPGSYKTLQGSELLLLGTGSIAKHLAQTAKHFGMKVAGINRSAKATEGF 171 + Q K+W L + + GS L++ G G I A+ A+ GM V+G R+ + EG Sbjct: 157 QDQAA-KVWPELRTPTRLVSGSTLVVTGLGEIGLETARIARALGMTVSGTKRNVEPIEGI 215 Query: 172 DEVATLEALPTLMARADAIASILPSTEATRGILNENILARMKPDAVLFNLGRGDVLDLDA 231 ++VA + L L+A ADA+ + LP T T + N + A MKP V N+GRG V+D DA Sbjct: 216 EQVAGNDGLAGLLASADAVVNTLPGTPYTEKLFNRGVFAAMKPGTVFVNVGRGTVVDEDA 275 Query: 232 LERQLRQHPQQQAVLDVFNQEPLPEDHPIWGLGNVIVTPHIAAPSFPEQ--VAEIFSSNY 289 L L A LDVF EPLP D P+W V+V+PH +A S E +AE F SN Sbjct: 276 LLEALGNGQVSYACLDVFAVEPLPLDSPLWNHPKVMVSPHTSALSAAENRLIAERFCSNL 335 Query: 290 HKFLLGETLSHRVN 303 FL G L H V+ Sbjct: 336 GIFLAGGDLPHLVD 349 Lambda K H 0.320 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 354 Length adjustment: 28 Effective length of query: 280 Effective length of database: 326 Effective search space: 91280 Effective search space used: 91280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory