Align homoserine kinase (EC 2.7.1.39) (characterized)
to candidate WP_058932002.1 AU252_RS18660 homoserine kinase
Query= BRENDA::P07128 (309 letters) >NCBI__GCF_001484605.1:WP_058932002.1 Length = 324 Score = 218 bits (556), Expect = 1e-61 Identities = 121/273 (44%), Positives = 167/273 (61%), Gaps = 10/273 (3%) Query: 5 LNVGRKVTVTVPGSSANLGPGFDTLGLALSVYDTVEVEIIPSG-LEVEVFGEGQGEVPLD 63 + G++VTV VP +SANLGPG+D+LGLAL+++DT+ VE + S L E+ GEG +P D Sbjct: 14 IEAGQRVTVRVPATSANLGPGYDSLGLALALHDTLTVESLESAELVFELSGEGADTLPQD 73 Query: 64 GSHLVVKAIRAGLKAADAEVPGLRVVCHNNIPQSRGLGSSAAAAVAGVAAANGLADFPLT 123 SHLVV+A+ A GLR+ N P RGLGSSA+A VA V+AAN + Sbjct: 74 ASHLVVRAMEAAFSRLGYRHGGLRITATNVNPHGRGLGSSASAVVAAVSAANAMVPEAAR 133 Query: 124 Q--EQIVQLSSAFEGHPDNAAASVLGGAVVSWTNLSIDGKSQPQYAAVPLEVQDNIRATA 181 + + I+QL+S EGHPDN A ++ GG +SW + +Y++ V ++ Sbjct: 134 RGRDWILQLTSEMEGHPDNVAPAIFGGLALSW-------QDSDRYSSTCATVAGSVIPIV 186 Query: 182 LVPNFHASTEAVRRVLPTEVTHIDARFNVSRVAVMIVALQQRPDLLWEGTRDRLHQPYRA 241 VP+F STEA R +LP V H A N R A++I AL Q+P+ L GT D LHQ YRA Sbjct: 187 AVPDFELSTEAARALLPASVGHHAAAMNSGRAALLIHALTQKPEFLHAGTEDYLHQSYRA 246 Query: 242 EVLPITSEWVNRLRNRGYAAYLSGAGPTAMVLS 274 E +P ++ + LRN G+AA +SGAGPT +VL+ Sbjct: 247 EAMPPSASLIRALRNSGHAAVVSGAGPTVLVLA 279 Lambda K H 0.315 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 229 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 324 Length adjustment: 27 Effective length of query: 282 Effective length of database: 297 Effective search space: 83754 Effective search space used: 83754 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate WP_058932002.1 AU252_RS18660 (homoserine kinase)
to HMM TIGR00191 (thrB: homoserine kinase (EC 2.7.1.39))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00191.hmm # target sequence database: /tmp/gapView.7609.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00191 [M=304] Accession: TIGR00191 Description: thrB: homoserine kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-69 219.5 0.0 2.7e-69 219.3 0.0 1.0 1 lcl|NCBI__GCF_001484605.1:WP_058932002.1 AU252_RS18660 homoserine kinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001484605.1:WP_058932002.1 AU252_RS18660 homoserine kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 219.3 0.0 2.7e-69 2.7e-69 1 301 [. 20 319 .. 20 321 .. 0.90 Alignments for each domain: == domain 1 score: 219.3 bits; conditional E-value: 2.7e-69 TIGR00191 1 lkvkvPassANlgpGfDvlGlalslvlellvtedvaqeskdksleaegegvekipkesdkNliyqvakk 69 ++v+vPa+sANlgpG+D+lGlal l + l+v+ es++ +e geg++++p++ l+ ++++ lcl|NCBI__GCF_001484605.1:WP_058932002.1 20 VTVRVPATSANLGPGYDSLGLALALHDTLTVES---LESAELVFELSGEGADTLPQD-ASHLVVRAMEA 84 689****************************99...8888888**************.899******** PP TIGR00191 70 vlkklgkrvkpvkltvekeiplgrGLGSSaaaivaaviaanelaglklskee..lldlalllEgHpDNv 136 + +lg r ++++t ++ p grGLGSSa+a+vaav aan+++ + + + +l+l +++EgHpDNv lcl|NCBI__GCF_001484605.1:WP_058932002.1 85 AFSRLGYRHGGLRITATNVNPHGRGLGSSASAVVAAVSAANAMVPEAARRGRdwILQLTSEMEGHPDNV 153 ********************************************99887654449************** PP TIGR00191 137 apallGGlqlavkeddllevlkvPsgsklkvvlviPnievsTaeaRavLPkaysrqdlvfnlshlavlv 205 apa++GGl l+ ++ d ++ ++ ++++P +e+sT++aRa+LP+++ +++ +n+ ++a+l+ lcl|NCBI__GCF_001484605.1:WP_058932002.1 154 APAIFGGLALSWQDSDRYSSTCATVAGSVIPIVAVPDFELSTEAARALLPASVGHHAAAMNSGRAALLI 222 ****************6666666666899999************************************* PP TIGR00191 206 tAlvskdkadllaiamkDrvhqpyRekliPelteikqaakekgalgitlSGaGptilalaeeek.eeka 273 +Al++k +++l+ +D +hq yR++ +P + + +a ++ g + ++SGaGpt+l+la+ e + + lcl|NCBI__GCF_001484605.1:WP_058932002.1 223 HALTQK--PEFLHAGTEDYLHQSYRAEAMPPSASLIRALRNSG-HAAVVSGAGPTVLVLADGEAeAAEV 288 *****9..9**********************999999988886.57789************99867777 PP TIGR00191 274 qelleklakegi.eltvkvle..ldtdgaev 301 +e+++++++ + ++vl+ +d +ga+v lcl|NCBI__GCF_001484605.1:WP_058932002.1 289 LGFIESFTEANTpGIGWRVLKlaVDVEGAKV 319 7888888776541445665541156677765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (324 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 12.22 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory