Align threonine synthase (EC 4.2.3.1) (characterized)
to candidate WP_056349448.1 AU252_RS18655 threonine synthase
Query= BRENDA::P9WG59 (360 letters) >NCBI__GCF_001484605.1:WP_056349448.1 Length = 368 Score = 415 bits (1067), Expect = e-121 Identities = 220/365 (60%), Positives = 267/365 (73%), Gaps = 16/365 (4%) Query: 9 HQPWPGVIAAYRDRLPVGDDWTPVTLLEGGTPLIAATNLSKQTGCTIHLKVEGLNPTGSF 68 HQ W GVI Y DRLPV + +TL EGGTPL+ A LS+ TG T++LKVEG+NPTGSF Sbjct: 3 HQ-WRGVIREYADRLPVTESTRVITLGEGGTPLVHAQKLSELTGSTVYLKVEGMNPTGSF 61 Query: 69 KDRGMTMAVTDALAHGQRAVLCASTGNTSASAAAYAARAGITCAVLIPQGKIAMGKLAQA 128 KDRGMTMA+T A+A G +AV+CASTGNTSASAAAYA AG+ CAVL+P+GKI+MGKL+QA Sbjct: 62 KDRGMTMAMTAAVASGAKAVVCASTGNTSASAAAYATAAGLKCAVLVPEGKISMGKLSQA 121 Query: 129 VMHGAKIIQIDGNFDDCLELARKMAADFPTISLVNSVNPVRIEGQKTAAFEIVDVLGTAP 188 + HGA ++Q+DGNFD+CL++ARK+ +P + LVNSVNP RI+GQKT AFEIVD LG AP Sbjct: 122 IAHGATLLQVDGNFDNCLDIARKLGESYP-VFLVNSVNPARIQGQKTGAFEIVDSLGDAP 180 Query: 189 DVHALPVGNAGNITAYWKGYTEYHQ----------LGLIDKLPRMLGTQAAGAAPLVLGE 238 D+H LPVGNAGNITAYWKGY EY + K P+M G QAAGAAP V G Sbjct: 181 DIHVLPVGNAGNITAYWKGYKEYSAPFESETAGTLPAVSTKTPQMWGFQAAGAAPFVAGH 240 Query: 239 PVSHPETIATAIRIGSPASWTSAVEAQQQSKGRFLAASDEEILAAYHLVARVEGVFVEPA 298 P++ P+TIATAIRIG+PASW A+ A+ +S G A +DE+IL A+ ++ EGVFVEP Sbjct: 241 PITEPDTIATAIRIGNPASWDGAIAARDESGGFIDAVTDEQILDAHRWLSAREGVFVEPG 300 Query: 299 SAASIAGLLKAIDDGWVARGSTVVCTVTGNGLKDPDTALK--DMPSVSPVPV--DPVAVV 354 SAA +AGLLK G V G T+V TVTG+GLKDP AL+ D V PV V D V V Sbjct: 301 SAAGVAGLLKKHAAGEVPTGKTIVITVTGHGLKDPQWALRTEDGSEVQPVKVSNDVVTVA 360 Query: 355 EKLGL 359 +LGL Sbjct: 361 AELGL 365 Lambda K H 0.317 0.132 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 427 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 368 Length adjustment: 29 Effective length of query: 331 Effective length of database: 339 Effective search space: 112209 Effective search space used: 112209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_056349448.1 AU252_RS18655 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.6505.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.5e-91 290.6 0.0 1.1e-90 290.2 0.0 1.1 1 lcl|NCBI__GCF_001484605.1:WP_056349448.1 AU252_RS18655 threonine synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001484605.1:WP_056349448.1 AU252_RS18655 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 290.2 0.0 1.1e-90 1.1e-90 3 339 .. 11 335 .. 9 336 .. 0.96 Alignments for each domain: == domain 1 score: 290.2 bits; conditional E-value: 1.1e-90 TIGR00260 3 ryreilevt.ekdlvdlaegstelfrspklaeevgaenlyvkelfhgPtlaFKDrglqfvavlltkale 70 y+ l+vt +++++l eg t+l++++kl+e g+ +y+k ++++Pt++FKDrg +++++t+a lcl|NCBI__GCF_001484605.1:WP_056349448.1 11 EYADRLPVTeSTRVITLGEGGTPLVHAQKLSELTGS-TVYLKVEGMNPTGSFKDRG---MTMAMTAAVA 75 678899***999*****************9987777.*******************...********** PP TIGR00260 71 lgnetvlcAtsGdtgaaaaealagkanvkvvvLyPkgkispvkeklvtalaenakvlaikGdFDdaqdl 139 g+++v+cA++G+t+a+aa a+a a++k+ vL+P+gkis +kl +a+a++a++l+++G+FD+++d+ lcl|NCBI__GCF_001484605.1:WP_056349448.1 76 SGAKAVVCASTGNTSASAA-AYATAAGLKCAVLVPEGKIS--MGKLSQAIAHGATLLQVDGNFDNCLDI 141 *******************.********************..*************************** PP TIGR00260 140 vkeifedkeklklnsvNsinparieaqktyafeiveqlgkespdkvvvpvp.sgnfgailkGflekkel 207 +++ e + ++nsvN pari++qkt afeiv+ lg ++pd v+pv+ +gn++a++kG++e+ lcl|NCBI__GCF_001484605.1:WP_056349448.1 142 ARKLGESYPVFLVNSVN---PARIQGQKTGAFEIVDSLG-DAPDIHVLPVGnAGNITAYWKGYKEYSAP 206 *****999999999999...*******************.9**********************998654 PP TIGR00260 208 g..............lpieklaiaaegaadivrrflksgdlepkedkeTlstAmdignpsnveralela 262 p ++ +++a gaa++v p+++++T++tA++ignp++++ a ++ lcl|NCBI__GCF_001484605.1:WP_056349448.1 207 FesetagtlpavstkTP-QMWGFQAAGAAPFVAGH-------PITEPDTIATAIRIGNPASWDGAIAAR 267 4455566******9999.**********9999988.......*************************** PP TIGR00260 263 rrslgnledlkesvsdeeileaikklaeeegyllephtavavaalkklvekgvsatadpaKFeevveal 331 +s+g ++++ +de+il+a + l ++eg+++ep +a++va+l+k +++g +++ + +++v + lcl|NCBI__GCF_001484605.1:WP_056349448.1 268 DESGGFIDAV----TDEQILDAHRWLSAREGVFVEPGSAAGVAGLLKKHAAG---EVPTG--KTIVITV 327 **********....**************************************...*****..******* PP TIGR00260 332 tgnklkdp 339 tg++lkdp lcl|NCBI__GCF_001484605.1:WP_056349448.1 328 TGHGLKDP 335 ******98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (368 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.04 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory