Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate WP_058930730.1 AU252_RS10910 PLP-dependent aminotransferase family protein
Query= BRENDA::A0A060PQX5 (417 letters) >NCBI__GCF_001484605.1:WP_058930730.1 Length = 434 Score = 325 bits (833), Expect = 2e-93 Identities = 161/398 (40%), Positives = 246/398 (61%), Gaps = 1/398 (0%) Query: 18 YEKYFSKKALGMKASEVRELLKLVESSDVISLAGGLPAPETFPVEIIAEITKEVLEKHAA 77 +E FS++A +K S VR++ + ++SLAGG P ++ P+E +A ++ Sbjct: 35 HEALFSERAANIKQSAVRDVFDISMRPGLVSLAGGSPYLQSLPLERLAATAASIIANEGL 94 Query: 78 QALQYGTTKGFTPLRLALAEWMRKRYDIPISKVDIMITSGSQQALDLIGRVFINPGDIVV 137 ALQYG +G LR + E M + +++IT+GSQ A D+ +VF NPGD+V+ Sbjct: 95 TALQYGGGQGTEELRTQICEVMAAEGILDALPRNVVITAGSQSAQDVATKVFCNPGDVVL 154 Query: 138 VEAPTYLAALQAFKYYEPEFVQIPLDDEGMRVDLLEEKLQELEKEGKKVKLVYTIPTFQN 197 VE PTY+ AL F+ Y+ E + +DD+G+ +LLE ++ L+ GK +K +YTIP F N Sbjct: 155 VENPTYVGALNTFEAYQVEVATVEMDDDGLVPELLEARIAALQTAGKNIKFLYTIPNFNN 214 Query: 198 PAGVTMSEKRRKRLLELASEYDFLIVEDNPYGELRYSGEPVKPIKAWDDEGRVMYLGTFS 257 P+G+T++ +RR+R++++ + + L++EDNPYG LRY+G P++P++A + V+Y+G+FS Sbjct: 215 PSGITLAGERRQRVVDICRKANILVLEDNPYGLLRYNGTPLEPLRA-ANPADVIYMGSFS 273 Query: 258 KILAPGFRIGWIAAEPHLIRKLEIAKQSVDLCTNPFSQVIAWKYVEGGHLDNHIPNIIEF 317 KI APG RIGW HL R+ +A +SV LC +Q++ Y+ I Sbjct: 274 KIFAPGLRIGWALVPEHLQRRYYLASESVTLCPPTLNQMLVSAYLSDYDWKGQIETYRGL 333 Query: 318 YKPRRDAMLKALEEFMPEGVRWTKPEGGMFVWVTLPEGIDTKLMLEKAVAKGVAYVPGEA 377 Y R AML AL+E MP G WT PEGG FVWVTLP G+DT +L+KA+ GV ++PG A Sbjct: 334 YAERCTAMLAALDEHMPAGTSWTSPEGGFFVWVTLPAGVDTYPLLQKAIDAGVVFIPGAA 393 Query: 378 FFAHRDVKNTMRLNFTYVPEEKIREGIKRLAETIKEEM 415 F N +RL F+ VP + I+EG++RLA ++E + Sbjct: 394 FTPSDSPSNKLRLAFSAVPPDAIKEGVRRLAPVLREAL 431 Lambda K H 0.318 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 491 Number of extensions: 31 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 434 Length adjustment: 32 Effective length of query: 385 Effective length of database: 402 Effective search space: 154770 Effective search space used: 154770 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory