Align homoserine dehydrogenase (EC 1.1.1.3) (characterized)
to candidate WP_068461703.1 APY04_RS08640 homoserine dehydrogenase
Query= reanno::Korea:Ga0059261_2711 (430 letters) >NCBI__GCF_001541235.1:WP_068461703.1 Length = 443 Score = 355 bits (912), Expect = e-102 Identities = 202/440 (45%), Positives = 268/440 (60%), Gaps = 14/440 (3%) Query: 1 MTEPLRVALAGLGTVGAGVIRLIDANAELIARRAGRPIEIVAVSARDRAKDRGVDITR-F 59 MT+ L++ +AGLGTVG +I L+ + + +A G +++VAVSAR + K R + T Sbjct: 1 MTKSLKLGVAGLGTVGTSLIELLATHRDRLAN-LGSTVDVVAVSARSKDKHRAIAETAGV 59 Query: 60 DWVDDMTELARHPKADVVVELIGGSDGPALALARATLAAGKGLVTANKAMIAHHGLELAQ 119 W DD LAR P DV VELIGG DG A A L AGK +VTANKA++A HG+ LAQ Sbjct: 60 TWFDDPIALARDPAIDVFVELIGGEDGVAKEAVEAALNAGKHVVTANKALLAKHGVALAQ 119 Query: 120 VAEKSDTPMKFEAAVAGGVPVIKGLREGAAANQIDRVYGILNGTCNFILSKMEAEGRDFG 179 +AE+ + FEAAVAGG+PVIK LRE AAN + RVYGILNGTCN+ILS M E R FG Sbjct: 120 LAEEKGVALNFEAAVAGGIPVIKTLRESLAANSVRRVYGILNGTCNYILSTMTDEKRSFG 179 Query: 180 EVLAEAQAAGFAEADPSFDIDGVDAAHKLSILASIAFGTQPAFGDVAIGGIRHLLAADIA 239 + L EAQ G+AEADP+FDI G D AHKL+ILAS+AFGT+ F ++ + GI+ + ADI Sbjct: 180 DALKEAQDLGYAEADPTFDIGGFDTAHKLAILASLAFGTEINFDEIDVEGIQSITDADIE 239 Query: 240 EAAALGYRIRLLGIADLSGNGLFQRVHPHLVPLSHPLAHVLGPTNAVVAEGNFVGRLLFQ 299 A +GY I+LLG+A + +G+ RV+P +VP +A V G TN V + +F G LL Sbjct: 240 AAEDMGYCIKLLGVATQTDSGIEMRVNPAMVPEESAIAEVWGATNGVAIDSDFCGSLLLV 299 Query: 300 GAGAGDGPTASAVVADLIDIARTEFGPPYAMPATSLAAEPVAPTGERRGRAYLRFTVADK 359 G GAG TAS+V D++DIAR PP A SL + G +G Y+R +V D+ Sbjct: 300 GPGAGGKATASSVAGDIVDIARGIILPPLMRKAASLTPCVRSKLGSHQGAYYVRLSVYDR 359 Query: 360 VGVLAEIAAAMRDAGVSIESLIQ------------RGAMADGSVLVAIVTHEVPERSIAQ 407 G +A IA M D +SIES++Q R + V I+THE E +I Q Sbjct: 360 PGTMAAIAKHMGDRDISIESMVQGQMRAGVPGAEARTKVRGAPAPVRIITHETTEEAIRQ 419 Query: 408 ALEKLRGSPSLAGEPMWMHI 427 A+E + ++ P + I Sbjct: 420 AVEAIEQDGKVSERPQVIRI 439 Lambda K H 0.319 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 432 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 430 Length of database: 443 Length adjustment: 32 Effective length of query: 398 Effective length of database: 411 Effective search space: 163578 Effective search space used: 163578 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory