Align homoserine kinase (EC 2.7.1.39) (characterized)
to candidate WP_066920366.1 ACG33_RS08525 homoserine kinase
Query= reanno::Dyella79:N515DRAFT_0576 (330 letters) >NCBI__GCF_001579945.1:WP_066920366.1 Length = 311 Score = 281 bits (720), Expect = 1e-80 Identities = 157/307 (51%), Positives = 194/307 (63%), Gaps = 4/307 (1%) Query: 22 SAQALAPASVGNVGIGFDILGHSVAGAGDRARVRRIDEPVVRIAAIEGCVVDLPLDPAQN 81 SA APASVGNV +GFD+LGHS GDR RR EP VRI AI G +LP P N Sbjct: 4 SATVFAPASVGNVAVGFDVLGHSFQAIGDRVTARRTQEPGVRITAIHGVATELPTAPENN 63 Query: 82 TAGMALMALRKALGLRHGFELVLHKGIALGSGMGGSASSCVAALVAANALLERPLPMESL 141 TAGM ++++ + L + G EL + KGI LGSG+GGSA+S VAA+VA +ALL RPL L Sbjct: 64 TAGMGVLSMVRELEVDFGIELSIEKGIPLGSGLGGSAASAVAAVVAMDALLPRPLSKIEL 123 Query: 142 YGFALEGEAVASGGRHGDNVGPMLLGGLVL--ATRDRLVR-VPVPDAWHCALVHPHMVLE 198 FA++GE VASG H DN+ P L GGLVL D V+ +PVP + C LVHPHM+L Sbjct: 124 LKFAMKGEQVASGTVHVDNIAPSLFGGLVLTVGVDDPYVKQIPVPPSVRCVLVHPHMMLA 183 Query: 199 TRKARAALAGAYQLGEFVAQSANLSLMLAGCWQGDAGLVREGLNDVLVEPRRAPLIPGFA 258 TR+AR L + L + + QSANL+ L GC+ D L+R L DV+VEP+R LIPGF Sbjct: 184 TREARQLLKRSIDLSDVIWQSANLAGFLTGCFTDDLQLIRASLEDVIVEPQRKALIPGFQ 243 Query: 259 RVKQAAMDHRAMGASISGAGPSVFGWFEQRDEAKAAAAAMAAAFAEAGLDSDTLVSPIAG 318 VK AM A+G SISGAGP+VF W E+ +A AM A FA GL+ D VS + Sbjct: 244 AVKDGAMAQGALGCSISGAGPTVFAWCEE-PQAHGVRDAMVAGFAAHGLECDAWVSTLEP 302 Query: 319 PSAALID 325 A +ID Sbjct: 303 IGARVID 309 Lambda K H 0.320 0.134 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 311 Length adjustment: 28 Effective length of query: 302 Effective length of database: 283 Effective search space: 85466 Effective search space used: 85466 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_066920366.1 ACG33_RS08525 (homoserine kinase)
to HMM TIGR00191 (thrB: homoserine kinase (EC 2.7.1.39))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00191.hmm # target sequence database: /tmp/gapView.5762.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00191 [M=304] Accession: TIGR00191 Description: thrB: homoserine kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-69 219.8 0.0 2.2e-69 219.6 0.0 1.0 1 lcl|NCBI__GCF_001579945.1:WP_066920366.1 ACG33_RS08525 homoserine kinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001579945.1:WP_066920366.1 ACG33_RS08525 homoserine kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 219.6 0.0 2.2e-69 2.2e-69 2 301 .. 6 307 .. 5 310 .. 0.92 Alignments for each domain: == domain 1 score: 219.6 bits; conditional E-value: 2.2e-69 TIGR00191 2 kvkvPassANlgpGfDvlGlalslvlellvtedvaqeskdksleaegegvekipkesdkNliyqvakkv 70 +v +Pas N+++GfDvlG + + + + + +qe ++a + ++p+ +++N + ++ + lcl|NCBI__GCF_001579945.1:WP_066920366.1 6 TVFAPASVGNVAVGFDVLGHSFQAIGDRVTAR-RTQEPGVR-ITAIHGVATELPTAPENNTAGMGVLSM 72 588********************998766555.46666666.7777777799***************** PP TIGR00191 71 lkklgkrvkpvkltvekeiplgrGLGSSaaaivaaviaanelaglklskeelldlalllEg......Hp 133 +++l+ + +++l +ek iplg+GLG Saa+ vaav+a+++l+ +lsk ell++a+ E+ H lcl|NCBI__GCF_001579945.1:WP_066920366.1 73 VRELEVD-FGIELSIEKGIPLGSGLGGSAASAVAAVVAMDALLPRPLSKIELLKFAMKGEQvasgtvHV 140 *******.************************************************************* PP TIGR00191 134 DNvapallGGlqlavkeddllevlkvPsgsklkvvlviPnievsTaeaRavLPkaysrqdlvfnlshla 202 DN+ap+l+GGl+l+v dd v ++P +++ +vlv P++ + T+eaR++L ++ +++d++ ++++la lcl|NCBI__GCF_001579945.1:WP_066920366.1 141 DNIAPSLFGGLVLTVGVDD-PYVKQIPVPPSVRCVLVHPHMMLATREARQLLKRSIDLSDVIWQSANLA 208 ******************9.888889988**************************************** PP TIGR00191 203 vlvtAlvskdkadllaiamkDrvhqpyRekliPelteikqaakekgalgitlSGaGptilalaeeek.e 270 ++ t + ++ +l++ ++D++ +p R+ liP+++++k a ++galg +SGaGpt++a +ee + + lcl|NCBI__GCF_001579945.1:WP_066920366.1 209 GFLTGCFTD-DLQLIRASLEDVIVEPQRKALIPGFQAVKDGAMAQGALGCSISGAGPTVFAWCEEPQaH 276 ********9.899******************************************************55 PP TIGR00191 271 ekaqelleklakegieltvkvleldtdgaev 301 ++ +a +g e+ v +l+ ga+v lcl|NCBI__GCF_001579945.1:WP_066920366.1 277 GVRDAMVAGFAAHGLECDAWVSTLEPIGARV 307 5666778888888888887777777677766 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (311 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.24 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory