Align threonine synthase (EC 4.2.3.1) (characterized)
to candidate WP_066920364.1 ACG33_RS08520 threonine synthase
Query= reanno::Dyella79:N515DRAFT_0575 (441 letters) >NCBI__GCF_001579945.1:WP_066920364.1 Length = 433 Score = 432 bits (1112), Expect = e-126 Identities = 231/425 (54%), Positives = 283/425 (66%), Gaps = 4/425 (0%) Query: 7 YHSTRGAAHGAGIGEAIAAGLAPDGGLYVPEALPSRRPDDFDPDGTLADTAARLLRPFFA 66 Y STR + EAIA G+APDGGLYVPE P +F+ + +A LL PF Sbjct: 3 YISTRDETQKLTLSEAIARGIAPDGGLYVPERFPRFLNSNFEGESEIAGIGPLLLAPFAE 62 Query: 67 GHALAAELPAICAEAFCFDAPLRPLPQHPG-AAMLELFHGPSAAFKDFGARFLASCFRRL 125 +LA EL IC EAF F PL PL P A++LELFHGP+ AFKD GARFLA+C +R+ Sbjct: 63 DDSLADELSVICREAFDFPVPLLPLEGAPAPASVLELFHGPTCAFKDIGARFLAACLQRI 122 Query: 126 RKAGEAPLTILVATSGDTGAAVAAAFHRQPGVEVVILYPDGLVSPRQAHQLGCFGDNVRA 185 RK LTILVATSGDTG AVAAAFH +P V+VV+LYP GLVS RQA QL C+G NVR Sbjct: 123 RKEAPRKLTILVATSGDTGGAVAAAFHDRPWVDVVVLYPKGLVSERQAQQLACWGGNVRT 182 Query: 186 LRVAGRFDDCQRMVKAALNDTALQAQRPLSSANSISLGRLLPQMAYYAHASLRWWREHRR 245 V G FDDCQRMVK A D +L LSSANSI++GRLLPQM YYA A L WR+ + Sbjct: 183 FAVHGTFDDCQRMVKEAFQDPSLAQTHQLSSANSINIGRLLPQMTYYAKAGLEVWRQTGQ 242 Query: 246 PLNFIVPTGNLGNALAAVWVREMGLPVGAIELACNANETLPDYFAGTPYAPRAAVATLAN 305 NFI+PTGNLGNALA +W R +GLP+G I LA NAN+T+ +Y + PRA+V TLA+ Sbjct: 243 RANFIIPTGNLGNALACLWARHVGLPIGEIVLATNANQTITEYLHSGEWQPRASVPTLAS 302 Query: 306 AMDVGAPSNFERLRWTFPYDDDLRGQLSSHSVDDDTIRATVRRHALEHGEVFCPHTATA- 364 AMDVG PSN ERLR + L+GQ+S+ SVDD IR+T+RR A E +++CPH+ATA Sbjct: 303 AMDVGNPSNMERLRHLHADFETLQGQVSAFSVDDTEIRSTIRRDAHELNQLWCPHSATAA 362 Query: 365 --MHRLDLRQEKADWAVVSTAHAAKFESVVEPLIGRGVAVPPALQAMLARPAQAEAIEAS 422 RL R + W +V+TAH AKF +VEP GR V VP +L +LA P Q ++ + Sbjct: 363 EVFRRLISRGARGHWVIVATAHPAKFNDIVEPHAGREVPVPSSLARLLALPRQEMELQPT 422 Query: 423 DDALK 427 AL+ Sbjct: 423 LQALR 427 Lambda K H 0.322 0.136 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 574 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 441 Length of database: 433 Length adjustment: 32 Effective length of query: 409 Effective length of database: 401 Effective search space: 164009 Effective search space used: 164009 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
Align candidate WP_066920364.1 ACG33_RS08520 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.11659.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-75 240.7 0.0 1.6e-75 240.4 0.0 1.1 1 lcl|NCBI__GCF_001579945.1:WP_066920364.1 ACG33_RS08520 threonine synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001579945.1:WP_066920364.1 ACG33_RS08520 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 240.4 0.0 1.6e-75 1.6e-75 38 330 .. 92 394 .. 62 403 .. 0.88 Alignments for each domain: == domain 1 score: 240.4 bits; conditional E-value: 1.6e-75 TIGR00260 38 enlyvkelfhgPtlaFKDrglqfvavlltkalelgne..tvlcAtsGdtgaaaaealagkanvkvvvLy 104 v+elfhgPt aFKD+g +f+a l++++++ t+l+AtsGdtg a+a a+ ++ v+vvvLy lcl|NCBI__GCF_001579945.1:WP_066920364.1 92 APASVLELFHGPTCAFKDIGARFLAACLQRIRKEAPRklTILVATSGDTGGAVAAAFHDRPWVDVVVLY 160 55569***************************9998889****************************** PP TIGR00260 105 PkgkispvkeklvtalaenakvlaikGdFDdaqdlvkeife...dkeklklnsvNsinparieaqktya 170 Pkg +s + + + +n++++a++G+FDd+q++vke+f+ + ++l+s+Nsin++r++ q+ty+ lcl|NCBI__GCF_001579945.1:WP_066920364.1 161 PKGLVSERQAQQLACWGGNVRTFAVHGTFDDCQRMVKEAFQdpsLAQTHQLSSANSINIGRLLPQMTYY 229 ******775555566799**********************9544455*******************888 PP TIGR00260 171 feiveqlgkespdkvvvpvpsgnfgailkGflekkelglpieklaiaaegaadivrrflksgdlepked 239 + ++ +++ ++ + +p gn+g++l+ l ++++glpi + a++ + +++++l+sg+++p+++ lcl|NCBI__GCF_001579945.1:WP_066920364.1 230 AKAGLEVWRQTGQRANFIIPTGNLGNALAC-LWARHVGLPIGEIVLATNAN-QTITEYLHSGEWQPRAS 296 888777777999******************.7777778**99998888887.9**************** PP TIGR00260 240 keTlstAmdignpsnverale...larrslgnledlkesvsdeeileaikklaeeegyllephtavava 305 + Tl+ Amd+gnpsn+er+ + ++ +g++ + sv d ei ++i++ a+e + l ph+a+a + lcl|NCBI__GCF_001579945.1:WP_066920364.1 297 VPTLASAMDVGNPSNMERLRHlhaDFETLQGQVSAF--SVDDTEIRSTIRRDAHELNQLWCPHSATAAE 363 *******************99654566777777777..9****************************** PP TIGR00260 306 alkklvekg.vs.....atadpaKFeevvea 330 + ++l+ g + ata+paKF+++ve lcl|NCBI__GCF_001579945.1:WP_066920364.1 364 VFRRLISRGaRGhwvivATAHPAKFNDIVEP 394 *********83345678************85 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (433 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.25 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory