Align 3-dehydroquinate synthase (EC 4.2.3.4) (characterized)
to candidate WP_068174426.1 HTA01S_RS19525 3-dehydroquinate synthase
Query= BRENDA::P07639 (362 letters) >NCBI__GCF_001592305.1:WP_068174426.1 Length = 373 Score = 373 bits (957), Expect = e-108 Identities = 198/351 (56%), Positives = 241/351 (68%), Gaps = 3/351 (0%) Query: 2 ERIVVTLGERSYPITIASGLFNEPASFLPLKSGEQVMLVTNETLAPLYLDKVRGVLEQAG 61 E++ + LG+RSY I I GL + +S+ L + ++VTNET+APLYL +++ L Sbjct: 11 EQVQIHLGDRSYSIVIGPGLLDASSSYAGLPTAASAVIVTNETVAPLYLLRLQTALASHF 70 Query: 62 VNVDSVILPDGEQYKSLAVLDTVFTALLQKPHGRDTTLVALGGGVVGDLTGFAAASYQRG 121 + V LPDGE +K+ L+ +F ALL+ R T L ALGGGVVGD+TGFAAASY RG Sbjct: 71 DTIHVVTLPDGEAFKTWESLNLIFDALLRHGCDRKTVLFALGGGVVGDMTGFAAASYMRG 130 Query: 122 VRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASVVVDLDCLKTLPPRELASG 181 V F+QVPTTLL+QVDSSVGGKTA+NHPLGKNMIGAFYQP V+ DLD L TLPPREL++G Sbjct: 131 VPFVQVPTTLLAQVDSSVGGKTAINHPLGKNMIGAFYQPQRVICDLDTLNTLPPRELSAG 190 Query: 182 LAEVIKYGIILDGAFFNWLEENLDALLRLDGPAMAYCIRRCCELKAEVVAADERETGLRA 241 LAEVIKYG I D AF W+E ++ LL D MAY +RR CE+KA VV DERE+GLRA Sbjct: 191 LAEVIKYGPIADMAFLEWMEAHVAELLARDPATMAYAVRRSCEIKAHVVGQDERESGLRA 250 Query: 242 LLNLGHTFGHAIEAEMGYGNWLHGEAVAAGMVMAARTSERLGQFSSAETQRIITLLKRAG 301 +LN GHTFGHAIEA MGYG WLHGEAV GMVMAAR S+RLG R+ L++R G Sbjct: 251 ILNFGHTFGHAIEAGMGYGRWLHGEAVGCGMVMAARLSQRLGLVEDGFVVRLTRLIERVG 310 Query: 302 LPVNGP---REMSAQAYLPHMLRDKKVLAGEMRLILPLAIGKSEVRSGVSH 349 LPV P +A YL M DKK AGE++ +L G + VR H Sbjct: 311 LPVVAPVLDGADNAGRYLALMRVDKKSEAGEIKFVLIDGSGNALVRGAPDH 361 Lambda K H 0.320 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 348 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 373 Length adjustment: 30 Effective length of query: 332 Effective length of database: 343 Effective search space: 113876 Effective search space used: 113876 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_068174426.1 HTA01S_RS19525 (3-dehydroquinate synthase)
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.26300.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-119 384.0 0.0 4e-119 383.8 0.0 1.0 1 lcl|NCBI__GCF_001592305.1:WP_068174426.1 HTA01S_RS19525 3-dehydroquinate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001592305.1:WP_068174426.1 HTA01S_RS19525 3-dehydroquinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 383.8 0.0 4e-119 4e-119 1 333 [. 22 357 .. 22 368 .. 0.95 Alignments for each domain: == domain 1 score: 383.8 bits; conditional E-value: 4e-119 TIGR01357 1 ykvkvgegllkklveelae.kasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKsletv 68 y++++g gll++ +++ +a ++v++t+e+v+ l+ +l+ al+s +++v+++pdge K++e++ lcl|NCBI__GCF_001592305.1:WP_068174426.1 22 YSIVIGPGLLDASSSYAGLpTAASAVIVTNETVAPLYLLRLQTALASHFDTIHVVTLPDGEAFKTWESL 90 689999****97777766567799***********************99999***************** PP TIGR01357 69 aklldqlleeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlplg 137 + + d+ll+++++rk+vl a+GGGvvgD++GF+Aa+y+RG+++vqvPTtlla+vDssvGGKt+in+plg lcl|NCBI__GCF_001592305.1:WP_068174426.1 91 NLIFDALLRHGCDRKTVLFALGGGVVGDMTGFAAASYMRGVPFVQVPTTLLAQVDSSVGGKTAINHPLG 159 ********************************************************************* PP TIGR01357 138 kNliGafyqPkaVlidlkvletlperelreGmaEviKhgliadaelfeelekneklllklaelealeel 206 kN+iGafyqP+ V++dl++l+tlp rel++G+aEviK+g iad +++e++e + ++ll + + ++++ + lcl|NCBI__GCF_001592305.1:WP_068174426.1 160 KNMIGAFYQPQRVICDLDTLNTLPPRELSAGLAEVIKYGPIADMAFLEWMEAHVAELLAR-DPATMAYA 227 *******************************************************99976.5599**** PP TIGR01357 207 ikrsievKaevVeeDekesglRalLNfGHtlgHaiEallkyk.lsHGeaVaiGmvveaklseklgllka 274 ++rs+e+Ka+vV +De+esglRa+LNfGHt+gHaiEa ++y+ + HGeaV +Gmv++a+ls++lgl++ lcl|NCBI__GCF_001592305.1:WP_068174426.1 228 VRRSCEIKAHVVGQDERESGLRAILNFGHTFGHAIEAGMGYGrWLHGEAVGCGMVMAARLSQRLGLVED 296 ********************************************************************* PP TIGR01357 275 ellerlvallkklglptklkk...klsveellkallkDKKnegskiklvlleeiGkaalase 333 + rl++l++++glp+ + ++ +l+ + DKK+e+++ik+vl++ G+a ++ lcl|NCBI__GCF_001592305.1:WP_068174426.1 297 GFVVRLTRLIERVGLPVVAPVldgADNAGRYLALMRVDKKSEAGEIKFVLIDGSGNALVR-G 357 *****************9998777888999*************************99877.4 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (373 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.07 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory