Align 3-dehydroquinate synthase (EC 4.2.3.4) (characterized)
to candidate WP_078428496.1 BK574_RS09920 3-dehydroquinate synthase
Query= BRENDA::P07639 (362 letters) >NCBI__GCF_002019605.1:WP_078428496.1 Length = 363 Score = 256 bits (653), Expect = 9e-73 Identities = 141/348 (40%), Positives = 203/348 (58%), Gaps = 5/348 (1%) Query: 1 MERIVVTLGERSYPITIASGLFNEPASFLP---LKSGEQVMLVTNETLAPLYLDKVRGVL 57 ME++ + + Y + I G+ + +LP + V+++T++ +APLYL V+ + Sbjct: 1 MEQLHINTSSKQYSVWIGEGIRFKWNEYLPNSLQQKSSSVLIITDDHVAPLYLQDVKKHV 60 Query: 58 EQAGVNVDSVILPDGEQYKSLAVLDTVFTALLQKPHGRDTTLVALGGGVVGDLTGFAAAS 117 V ++P GEQ KS + T L+ R++ ++ALGGGV+GDL GF AA+ Sbjct: 61 VDQLSEVYEYVVPAGEQSKSFQQYYEIQTYALEIGLDRNSLIIALGGGVIGDLAGFVAAT 120 Query: 118 YQRGVRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASVVVDLDCLKTLPPRE 177 Y RG+ FIQ+PTTLL+ DSSVGGK +NH LGKNMIGAF+QP +V+ D + L++LP E Sbjct: 121 YMRGIPFIQIPTTLLAH-DSSVGGKVGINHSLGKNMIGAFHQPEAVLYDPEALQSLPLHE 179 Query: 178 LASGLAEVIKYGIILDGAFFNWLEENLDALLRLDGPAMAYCIRRCCELKAEVVAADERET 237 SG AE IK+ +I D + F W ++N+ + G + R +KA VV+ DE+ET Sbjct: 180 WRSGFAEAIKHSLIWDASLFQWFKDNIVDFTNIKGSLAEQLLLRSIRVKAAVVSEDEKET 239 Query: 238 GLRALLNLGHTFGHAIEAEMGYGNWLHGEAVAAGMVMAARTSERLGQFSSAETQRIITLL 297 G+RA+LN GHT GHAIE +GYG HGEAVA GM+ A R SER I L Sbjct: 240 GIRAILNFGHTLGHAIETGLGYGKITHGEAVAIGMIFAMRVSERYYNI-PLPVDEIKNWL 298 Query: 298 KRAGLPVNGPREMSAQAYLPHMLRDKKVLAGEMRLILPLAIGKSEVRS 345 + G + P ++ L M +DKK G +R++L +G+ EV S Sbjct: 299 TKLGFKTDIPSQLDVSQLLHTMKKDKKAHKGIIRMVLMKELGRVEVVS 346 Lambda K H 0.320 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 363 Length adjustment: 29 Effective length of query: 333 Effective length of database: 334 Effective search space: 111222 Effective search space used: 111222 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_078428496.1 BK574_RS09920 (3-dehydroquinate synthase)
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.26647.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-124 400.6 0.0 3.5e-124 400.4 0.0 1.0 1 lcl|NCBI__GCF_002019605.1:WP_078428496.1 BK574_RS09920 3-dehydroquinate s Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002019605.1:WP_078428496.1 BK574_RS09920 3-dehydroquinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 400.4 0.0 3.5e-124 3.5e-124 2 341 .. 14 354 .. 13 357 .. 0.95 Alignments for each domain: == domain 1 score: 400.4 bits; conditional E-value: 3.5e-124 TIGR01357 2 kvkvgegllkklveelae....kasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKsle 66 +v +geg+ k +e+l + k+s++++itd++v+ l+ + ++++ ++ +ev+++vvp+ge+sKs++ lcl|NCBI__GCF_002019605.1:WP_078428496.1 14 SVWIGEGIRFKWNEYLPNslqqKSSSVLIITDDHVAPLYLQDVKKHVVDQLSEVYEYVVPAGEQSKSFQ 82 56677777666666666555325599******************************************* PP TIGR01357 67 tvaklldqlleeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlp 135 ++ +++++ le +l+r+s+++a+GGGv+gDlaGFvAaty+RGi+++q+PTtlla+ DssvGGK+gin++ lcl|NCBI__GCF_002019605.1:WP_078428496.1 83 QYYEIQTYALEIGLDRNSLIIALGGGVIGDLAGFVAATYMRGIPFIQIPTTLLAH-DSSVGGKVGINHS 150 *******************************************************.************* PP TIGR01357 136 lgkNliGafyqPkaVlidlkvletlperelreGmaEviKhgliadaelfeelekneklllklaeleale 204 lgkN+iGaf+qP+aVl+d++ l++lp +e+r+G+aE+iKh+li+da+lf++ ++n +++++ + + +e lcl|NCBI__GCF_002019605.1:WP_078428496.1 151 LGKNMIGAFHQPEAVLYDPEALQSLPLHEWRSGFAEAIKHSLIWDASLFQWFKDNIVDFTNI-KGSLAE 218 ********************************************************999985.77**** PP TIGR01357 205 elikrsievKaevVeeDekesglRalLNfGHtlgHaiEallkyk.lsHGeaVaiGmvveaklseklgll 272 +l+ rsi+vKa vV+eDeke+g+Ra+LNfGHtlgHaiE+ l+y+ ++HGeaVaiGm++++++se+++++ lcl|NCBI__GCF_002019605.1:WP_078428496.1 219 QLLLRSIRVKAAVVSEDEKETGIRAILNFGHTLGHAIETGLGYGkITHGEAVAIGMIFAMRVSERYYNI 287 *******************************************99************************ PP TIGR01357 273 kaellerlvallkklglptklkkklsveellkallkDKKnegskiklvlleeiGkaalasevteeelle 341 + +++++++l klg +t+++++l+v++ll++++kDKK++++ i++vl++e+G++++ +v+ee ++e lcl|NCBI__GCF_002019605.1:WP_078428496.1 288 P-LPVDEIKNWLTKLGFKTDIPSQLDVSQLLHTMKKDKKAHKGIIRMVLMKELGRVEVV-SVDEEPIKE 354 *.999****************************************************99.887777665 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (363 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.06 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory