Align shikimate dehydrogenase (NADP+) (EC 1.1.1.25); 3-dehydroquinate dehydratase (EC 4.2.1.10) (characterized)
to candidate WP_075386823.1 BK574_RS12905 shikimate dehydrogenase
Query= BRENDA::A0A5H2X4C4 (538 letters) >NCBI__GCF_002019605.1:WP_075386823.1 Length = 283 Score = 149 bits (377), Expect = 1e-40 Identities = 103/288 (35%), Positives = 157/288 (54%), Gaps = 31/288 (10%) Query: 261 KVFGIIGKPVGHSKSPLLYNQAFKSAGFDGVFLHLLVD--DVASFLQTYSSTDFAGFSCT 318 K+FG+IG PVGHS SP ++N AF + + V D+ + + + + +GF+ T Sbjct: 3 KLFGLIGHPVGHSMSPSMHNNAFHLLHQNHHYHAFDVSEADLQAAIAGFRAIGISGFNIT 62 Query: 319 IPHKEAAVKCCDEVDPVAKSIGAVNCIIRRQSDAKLFGYNTDYVGAISAIEDGLRGSQNG 378 IPHK +K DEVD AK IGAVN ++ + +LFGYNTD G + ++ + G Q Sbjct: 63 IPHKVEVMKYLDEVDEEAKLIGAVNTVVN--DNGRLFGYNTDGEGYLQSLLK-VTGDQ-- 117 Query: 379 NSAGASPLNGKLFVVIGAGGAGKAL-----GYGAKEKGARVVIANRTYDRARELAETIGG 433 L ++IGAGGA +A+ YG +E + IANRT ++A LA Sbjct: 118 -------LKQMRVLLIGAGGAARAVLTVLSRYGVEE----LHIANRTKEKAASLASECNQ 166 Query: 434 DAL-----SLADLEN-FHPEDGMILANTTSIGMQPKVDETPIPKHALKHYSLVFDAVYTP 487 + S+ + E H D ++ NTTS+GM P VD+ PI + +K ++V D +Y P Sbjct: 167 SSKDAFVWSIEEAEQKLHQFD--LIINTTSVGMSPNVDQLPIALNNIKQDAVVSDLIYNP 224 Query: 488 KITRLLKEAEECGATIVSGLEMFIGQAYGQYERYTGLPAPKELFRKIM 535 T+LL+EAE GAT+++G+ MF+ Q +E++TG + KI+ Sbjct: 225 LKTKLLQEAEAKGATVLNGVGMFVEQGALAFEKWTGTKPDRNEMEKIV 272 Lambda K H 0.317 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 316 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 538 Length of database: 283 Length adjustment: 30 Effective length of query: 508 Effective length of database: 253 Effective search space: 128524 Effective search space used: 128524 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory