Align Branched-chain-amino-acid aminotransferase 2; BCAT 2; Vegetative protein 85; VEG85; EC 2.6.1.42 (characterized)
to candidate WP_078428432.1 BK574_RS09430 branched-chain amino acid aminotransferase
Query= SwissProt::P39576 (363 letters) >NCBI__GCF_002019605.1:WP_078428432.1 Length = 357 Score = 476 bits (1226), Expect = e-139 Identities = 228/354 (64%), Positives = 287/354 (81%) Query: 3 KQTIRVELTSTKKPKPDPNQLSFGRVFTDHMFVMDYAADKGWYDPRIIPYQPLSMDPAAM 62 K+ + + ++ KK + +QL FG+ FTDHMFVMDY+ DKGW+DPRI PY+ +++DPAAM Sbjct: 2 KEQLTIIESTNKKNRLADDQLVFGKHFTDHMFVMDYSIDKGWHDPRITPYETITLDPAAM 61 Query: 63 VYHYGQTVFEGLKAYVSEDDHVLLFRPEKNMERLNQSNDRLCIPQIDEEQVLEGLKQLVA 122 ++HYGQTVFEGLKAY +ED+ +LLFRPEKN ER+N+S++RL IP +DE+ VL LK+L+ Sbjct: 62 IFHYGQTVFEGLKAYRTEDNRILLFRPEKNFERMNRSSERLSIPSVDEKLVLHYLKELLR 121 Query: 123 IDKDWIPNAEGTSLYIRPFIIATEPFLGVAASHTYKLLIILSPVGSYYKEGIKPVKIAVE 182 ID+DW+P EG SLYIRPFIIATEP L +A S TY+ IILSPVGSYY EGI PVKI VE Sbjct: 122 IDQDWVPATEGYSLYIRPFIIATEPNLSLAPSSTYQFYIILSPVGSYYSEGIHPVKIFVE 181 Query: 183 SEFVRAVKGGTGNAKTAGNYASSLKAQQVAEEKGFSQVLWLDGIEKKYIEEVGSMNIFFK 242 E+ RAV+GGTG AKTAGNY+++ AQ+ A EKG+SQVLWLDGIEKKYIEEVGSMN+FFK Sbjct: 182 EEYTRAVRGGTGTAKTAGNYSAAYIAQEKATEKGYSQVLWLDGIEKKYIEEVGSMNVFFK 241 Query: 243 INGEIVTPMLNGSILEGITRNSVIALLKHWGLQVSERKIAIDEVIQAHKDGILEEAFGTG 302 INGE+VTP LNGSILEGITR S+I LLK W + V E++I++DE+ QA++ G LEE FGTG Sbjct: 242 INGEVVTPQLNGSILEGITRLSIIELLKDWQIPVVEKRISMDEIFQAYEKGELEEVFGTG 301 Query: 303 TAAVISPVGELIWQDETLSINNGETGEIAKKLYDTITGIQKGAVADEFGWTTEV 356 TAAV+SPVGEL W D ++IN+ +TG ++KKLY+T+T IQ G D + WT EV Sbjct: 302 TAAVVSPVGELTWNDCHMTINDKQTGNLSKKLYETLTRIQTGKDDDPYSWTVEV 355 Lambda K H 0.316 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 486 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 357 Length adjustment: 29 Effective length of query: 334 Effective length of database: 328 Effective search space: 109552 Effective search space used: 109552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_078428432.1 BK574_RS09430 (branched-chain amino acid aminotransferase)
to HMM TIGR01123 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01123.hmm # target sequence database: /tmp/gapView.24607.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01123 [M=313] Accession: TIGR01123 Description: ilvE_II: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-126 406.0 0.0 5.3e-126 405.8 0.0 1.0 1 lcl|NCBI__GCF_002019605.1:WP_078428432.1 BK574_RS09430 branched-chain ami Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002019605.1:WP_078428432.1 BK574_RS09430 branched-chain amino acid aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 405.8 0.0 5.3e-126 5.3e-126 1 313 [] 43 355 .. 43 355 .. 0.99 Alignments for each domain: == domain 1 score: 405.8 bits; conditional E-value: 5.3e-126 TIGR01123 1 WdeaelaseaeleldegsavlhYgqevfeGlkayRtadGkillfRpdanakRlrrsaerlllPeleeel 69 W++++++++++++ld++++++hYgq vfeGlkayRt+d +illfRp++n +R++rs+erl++P ++e+l lcl|NCBI__GCF_002019605.1:WP_078428432.1 43 WHDPRITPYETITLDPAAMIFHYGQTVFEGLKAYRTEDNRILLFRPEKNFERMNRSSERLSIPSVDEKL 111 ********************************************************************* PP TIGR01123 70 flealkqlvkadkdwvpkakseasLYlRPfliatednlGvkaakeylflvlasPvGaYfkgglapvsif 138 +l+ lk+l+++d+dwvp ++ + sLY+RPf+iate+nl +++++y f++++sPvG+Y+ +g++pv+if lcl|NCBI__GCF_002019605.1:WP_078428432.1 112 VLHYLKELLRIDQDWVPATE-GYSLYIRPFIIATEPNLSLAPSSTYQFYIILSPVGSYYSEGIHPVKIF 179 *****************777.9*********************************************** PP TIGR01123 139 veteyvRaapkGtGavkvgGnYaasllaqkkaaeqglddvvyldpvekkkieevGaaniflitkdgelv 207 ve+ey+Ra+ +GtG++k++GnY+a+ aq+ka+e+g+++v++ld +ekk+ieevG++n+f+ ++ ge+v lcl|NCBI__GCF_002019605.1:WP_078428432.1 180 VEEEYTRAVRGGTGTAKTAGNYSAAYIAQEKATEKGYSQVLWLDGIEKKYIEEVGSMNVFFKIN-GEVV 247 *************************************************************998.8*** PP TIGR01123 208 ttplsesiLegvtresllelakdlgleveereiaidelkaaveaGei..vfacGtaavitPvgelkieg 274 t++l +siLeg+tr s++el kd+++ v e++i++de+ +a e+Ge+ vf++Gtaav++Pvgel+ ++ lcl|NCBI__GCF_002019605.1:WP_078428432.1 248 TPQLNGSILEGITRLSIIELLKDWQIPVVEKRISMDEIFQAYEKGELeeVFGTGTAAVVSPVGELTWND 316 *********************************************9999******************** PP TIGR01123 275 kevevkseevGevtkklrdeltdiqyGkledkegWivev 313 +++++++++G+++kkl+++lt iq+Gk +d++ W+vev lcl|NCBI__GCF_002019605.1:WP_078428432.1 317 CHMTINDKQTGNLSKKLYETLTRIQTGKDDDPYSWTVEV 355 *************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (313 nodes) Target sequences: 1 (357 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.74 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory