Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate WP_085773694.1 B1812_RS12585 homoserine O-acetyltransferase
Query= SwissProt::Q9AAS1 (382 letters) >NCBI__GCF_002117405.1:WP_085773694.1 Length = 386 Score = 508 bits (1308), Expect = e-148 Identities = 249/373 (66%), Positives = 293/373 (78%), Gaps = 2/373 (0%) Query: 10 AGGGTWRFPANEPLRLDSGGVIEGLEIAYQTYGQLNADKSNAVLICHALTGDQHVASPHP 69 + G FP +PL D G VI L IAY+TYG LN K+NA+L+CHALTGDQ+ A HP Sbjct: 9 SNGKRVHFPPEKPLVTDGGRVIAPLTIAYETYGALNEAKNNAILLCHALTGDQYAAGVHP 68 Query: 70 TTGKPGWWQRLVGPGKPLDPARHFIICSNVIGGCMGSTGPASINPATGKTYGLSFPVITI 129 TGKPGWW LVGPG+P D R FII +NV+GGCMG+TGPASIN AT + +GL FPV+TI Sbjct: 69 VTGKPGWWDVLVGPGRPFDTNRFFIISTNVVGGCMGTTGPASINLATARPFGLDFPVVTI 128 Query: 130 ADMVRAQAMLVSALGVETLFAVVGGSMGGMQVQQWAVDYPERMFSAVVLASASRHSAQNI 189 DMVRAQAML+ LG+ETLF V GGSMGGMQV QWA YPER+F+A+ +A+A RHS+QNI Sbjct: 129 RDMVRAQAMLIDHLGIETLFCVAGGSMGGMQVLQWAASYPERVFAAMPIATAPRHSSQNI 188 Query: 190 AFHEVGRQAIMADPDWRGGAYAEHGVRPEKGLAVARMAAHITYLSEPALQRKFGRELQ-R 248 AFHEVGRQA+MADPDWR G Y E GVRPEKGLAVARMAAHITYLSE ALQRKFGR+LQ R Sbjct: 189 AFHEVGRQAVMADPDWRAGRYLEAGVRPEKGLAVARMAAHITYLSEQALQRKFGRKLQDR 248 Query: 249 DGLSWGFDADFQVESYLRHQGSSFVDRFDANSYLYITRAMDYFDIAASHGGVLAKAFTRA 308 ++ FDADFQ+ESYLR+QG +FV+RFDANSYL++TRA DYFD+AA +GG LA AF + Sbjct: 249 AAPTFSFDADFQIESYLRYQGLAFVERFDANSYLFVTRACDYFDLAADYGGSLALAF-KG 307 Query: 309 RNVRFCVLSFSSDWLYPTAENRHLVRALTAAGARAAFAEIESDKGHDAFLLDEPVMDAAL 368 RFCV+SF+SDWLYPT+++R +V AL A GA +F EIESDKGHDAFLL EP A Sbjct: 308 SKTRFCVISFTSDWLYPTSDSRAIVHALNAGGASVSFVEIESDKGHDAFLLYEPDFFATT 367 Query: 369 EGFLASAERDRGL 381 GFL +A RG+ Sbjct: 368 RGFLEAAANARGI 380 Lambda K H 0.321 0.135 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 484 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 386 Length adjustment: 30 Effective length of query: 352 Effective length of database: 356 Effective search space: 125312 Effective search space used: 125312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate WP_085773694.1 B1812_RS12585 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.19058.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-143 462.0 0.0 7.4e-143 461.8 0.0 1.0 1 lcl|NCBI__GCF_002117405.1:WP_085773694.1 B1812_RS12585 homoserine O-acety Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002117405.1:WP_085773694.1 B1812_RS12585 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 461.8 0.0 7.4e-143 7.4e-143 3 350 .. 20 371 .. 18 372 .. 0.98 Alignments for each domain: == domain 1 score: 461.8 bits; conditional E-value: 7.4e-143 TIGR01392 3 eeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk.GWWdellGpgraldt 70 ++l+++ G v+ +++ay+tyG ln++++Na+l+cHaltg++ +ag + + k GWWd l+Gpgr++dt lcl|NCBI__GCF_002117405.1:WP_085773694.1 20 KPLVTDGGRVIAPLTIAYETYGALNEAKNNAILLCHALTGDQYAAGVHPVTGKpGWWDVLVGPGRPFDT 88 78999*****************************************99987767*************** PP TIGR01392 71 sryfvvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgSlGG 139 +r+f++++Nv+G+c G+tgP+sin +t +p+g +fP+vtirD+v+aq++l+d+Lg+e+l++v GgS+GG lcl|NCBI__GCF_002117405.1:WP_085773694.1 89 NRFFIISTNVVGGCMGTTGPASINLATARPFGLDFPVVTIRDMVRAQAMLIDHLGIETLFCVAGGSMGG 157 ********************************************************************* PP TIGR01392 140 mqalewalsypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeee.qPekGLalARml 207 mq+l+wa+syperv +++++at++r+s+q+iaf+ev rqa+++Dp+++ G+y e + +PekGLa+ARm lcl|NCBI__GCF_002117405.1:WP_085773694.1 158 MQVLQWAASYPERVFAAMPIATAPRHSSQNIAFHEVGRQAVMADPDWRAGRYLEAGvRPEKGLAVARMA 226 ********************************************************************* PP TIGR01392 208 alltYrseesleerfgreakseeslassleeefsvesylryqgkkfverFdAnsYllltkaldthdlar 276 a++tY+se++l+++fgr+ ++++++++s++++f++esylryqg fverFdAnsYl +t+a d++dla+ lcl|NCBI__GCF_002117405.1:WP_085773694.1 227 AHITYLSEQALQRKFGRKLQDRAAPTFSFDADFQIESYLRYQGLAFVERFDANSYLFVTRACDYFDLAA 295 ********************************************************************* PP TIGR01392 277 grrdslkealkkikapvlvvgiesDllftleeqeelakalkaakle..yaeieseeGHDaFllekekve 343 ++ +sl+ a+k k++++v++++sD+l+++++++ +++al+a +++ ++eies++GHDaFll + + lcl|NCBI__GCF_002117405.1:WP_085773694.1 296 DYGGSLALAFKGSKTRFCVISFTSDWLYPTSDSRAIVHALNAGGASvsFVEIESDKGHDAFLLYEPDFF 364 *****************************************9998888***************998887 PP TIGR01392 344 elirefl 350 ++ r fl lcl|NCBI__GCF_002117405.1:WP_085773694.1 365 ATTRGFL 371 7777665 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (386 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.59 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory