Align acetylornithine deacetylase (EC 3.5.1.16) (characterized)
to candidate WP_086511020.1 BZY95_RS16665 acetylornithine deacetylase
Query= BRENDA::Q92Y75 (374 letters) >NCBI__GCF_002151265.1:WP_086511020.1 Length = 383 Score = 275 bits (704), Expect = 1e-78 Identities = 160/385 (41%), Positives = 221/385 (57%), Gaps = 19/385 (4%) Query: 1 MQAAEILGKLVGFRSVVGLPNNDVVSWIRGYLESHGIAVDVLPGPEGDRSNIFATIGPKE 60 M AAE+L +LVGF +V N D+++++ GYL+ HG+ + +G ++N+ A IGP Sbjct: 1 MTAAEMLERLVGFATVSRDSNLDLIAFVEGYLDEHGVKHWRVESDDGRKANLLARIGPDV 60 Query: 61 ARGYIISGHMDVVPAAETGWTSDPFRLRVEAD-RLYGRGTTDMKGFLAAVLAAVPKLAAM 119 G ++SGH DVVP W++DPF L + D +LYGRGT DMKGF+A LA +P+ Sbjct: 61 EGGVVLSGHTDVVPVDGQPWSTDPFTLIDKGDGKLYGRGTCDMKGFIACALAELPEWLKR 120 Query: 120 PLRRPLHLALSYDEEAGCRGVPHMIARLPELCRQPLGAIIGEPTGMRAIRAHKGKAAARL 179 L +P++LALSYDEE GC G P MI RL +P I+GEPT M+ + AHKG R Sbjct: 121 GLDKPIYLALSYDEEVGCIGAPRMIERLMADHPRPTAVIVGEPTLMQPVVAHKGATNLRT 180 Query: 180 TVRGRSGHSSRPDQGLNAIHGVAGVLTQAVAEADRL-VGGPFEHVFEPPYSSLQIGTVKG 238 TV GR+ HSS+ DQG++AIH A ++T+ L G + F +SSL +G + G Sbjct: 181 TVTGRASHSSQVDQGVSAIHVAARLVTKIEDVMSELRAEGRVDEAFNVAHSSLHVGKIAG 240 Query: 239 GQAVNIIPDSCEVEFEARAISGVDPAELLAPVRKTAEALTTLGFEVEWQELS-------- 290 G A+NI+ C E+E R + EL V A L E E Q + Sbjct: 241 GTAINIMARECTFEWEIRHLPSDRFEELFERVNAFAAEL-----EAEMQRRAPETSIVTE 295 Query: 291 ----AYPALSLEPDAPLAALLEELTGREALPAVSYGTEAGLFQRAGIDAIICGPGDIGRA 346 PAL+ + +A + L EL G + AV+Y TEAG FQR G+ +ICGPG I +A Sbjct: 296 ALNLTVPALADDNNAEVLDLCRELLGEQPSGAVAYATEAGQFQRVGLPTVICGPGSIRQA 355 Query: 347 HKPDEYILIDELMACRAMVEALGAR 371 H+PDEYI I++L A ++ALG R Sbjct: 356 HQPDEYIEIEQLAAGTRFMQALGRR 380 Lambda K H 0.319 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 383 Length adjustment: 30 Effective length of query: 344 Effective length of database: 353 Effective search space: 121432 Effective search space used: 121432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_086511020.1 BZY95_RS16665 (acetylornithine deacetylase)
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01892.hmm # target sequence database: /tmp/gapView.6492.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01892 [M=365] Accession: TIGR01892 Description: AcOrn-deacetyl: acetylornithine deacetylase (ArgE) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-132 428.1 0.1 1.6e-132 427.9 0.1 1.0 1 lcl|NCBI__GCF_002151265.1:WP_086511020.1 BZY95_RS16665 acetylornithine de Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002151265.1:WP_086511020.1 BZY95_RS16665 acetylornithine deacetylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 427.9 0.1 1.6e-132 1.6e-132 1 364 [. 5 377 .. 5 378 .. 0.96 Alignments for each domain: == domain 1 score: 427.9 bits; conditional E-value: 1.6e-132 TIGR01892 1 eilakLvafdsvsarsnvdlieyvedyleelgvavevlpvadgaeksnllaviGpkegagglvlsGhtD 69 e+l++Lv+f +vs+ sn+dli +ve+yl+e+gv+ +++ dg k nlla iGp + +gg+vlsGhtD lcl|NCBI__GCF_002151265.1:WP_086511020.1 5 EMLERLVGFATVSRDSNLDLIAFVEGYLDEHGVKHWRVESDDG-RKANLLARIGPDV-EGGVVLSGHTD 71 6799************************************999.9***********9.*********** PP TIGR01892 70 vvPvdeaaWtsDpfrLtek.dgrLYgrGtaDmkGFlalvLaavpdlaaakLkkPlhlvlsaDeevglaG 137 vvPvd+++W++Dpf+L +k dg+LYgrGt+DmkGF+a++La +p+ + L kP++l+ls+Deevg+ G lcl|NCBI__GCF_002151265.1:WP_086511020.1 72 VVPVDGQPWSTDPFTLIDKgDGKLYGRGTCDMKGFIACALAELPEWLKRGLDKPIYLALSYDEEVGCIG 140 ****************88769************************************************ PP TIGR01892 138 akklieala...rrpalaivGePtslvavRahkGkasakvtvrGreghssrpdrGvsaielaakllarl 203 a+++ie+l+ +rp+ +ivGePt +++v ahkG + tv+Gr +hss+ d+Gvsai++aa+l++++ lcl|NCBI__GCF_002151265.1:WP_086511020.1 141 APRMIERLMadhPRPTAVIVGEPTLMQPVVAHKGATNLRTTVTGRASHSSQVDQGVSAIHVAARLVTKI 209 *******998999******************************************************** PP TIGR01892 204 valadklkr.edleeaFtppyatlniGtvkGGkavniiaaaCelvlelRpipGmdpeellallekiaee 271 ++ +l+ + ++eaF++ +++l++G++ GG+a ni+a++C ++ e+R +p eel + +++ a+e lcl|NCBI__GCF_002151265.1:WP_086511020.1 210 EDVMSELRAeGRVDEAFNVAHSSLHVGKIAGGTAINIMARECTFEWEIRHLPSDRFEELFERVNAFAAE 278 ******987689****************************************************99988 PP TIGR01892 272 ....vkekapgfevkveels.atpaleleedaelvalleklaGa.aaevvsygteagllqelGieavvl 334 ++++ap++ +++e l+ + pal+ +++ae+ +l ++l+G+ + +v+y+teag++q++G+++v++ lcl|NCBI__GCF_002151265.1:WP_086511020.1 279 leaeMQRRAPETSIVTEALNlTVPALADDNNAEVLDLCRELLGEqPSGAVAYATEAGQFQRVGLPTVIC 347 676788999**999998876267*********************8889********************* PP TIGR01892 335 GPGdidqahqpdeYveieelkrcrallerl 364 GPG+i+qahqpdeY+eie+l ++ ++++l lcl|NCBI__GCF_002151265.1:WP_086511020.1 348 GPGSIRQAHQPDEYIEIEQLAAGTRFMQAL 377 **************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (383 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 12.19 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory