Align Argininosuccinate synthase; Citrulline--aspartate ligase; EC 6.3.4.5 (characterized)
to candidate WP_086510012.1 BZY95_RS11225 argininosuccinate synthase
Query= SwissProt::P59846 (400 letters) >NCBI__GCF_002151265.1:WP_086510012.1 Length = 406 Score = 516 bits (1330), Expect = e-151 Identities = 248/394 (62%), Positives = 311/394 (78%), Gaps = 4/394 (1%) Query: 2 KIVLAYSGGLDTSIILKWLKETYRAEVIAFTADIGQGEEVEEAREKALRTGASKAIALDL 61 K+VLAYSGGLDTS+I+KWL+ETY EV+ FTADIGQGEEVE AR KA G + DL Sbjct: 6 KVVLAYSGGLDTSVIVKWLQETYNCEVVTFTADIGQGEEVEPARAKAQALGVKEIYIEDL 65 Query: 62 KEEFVRDFVFPMMRAGAVYEGYYLLGTSIARPLIAKHLVRIAEEEGAEAIAHGATGKGND 121 +EEFVRD+V+PM RA +YEG YLLGTSIARPLIAK L+ IA E GA+AI+HGATGKGND Sbjct: 66 REEFVRDYVYPMFRANTIYEGEYLLGTSIARPLIAKRLIEIANETGADAISHGATGKGND 125 Query: 122 QVRFELTAYALKPDIKVIAPWREWSFQGRKEMIAYAEAHGIPVPVTQEK---PYSMDANL 178 QVRFE+ AYALKP +KVIAPWREW R++++AY E H IPV ++ K PYSMDANL Sbjct: 126 QVRFEMGAYALKPGVKVIAPWREWDLTSREKLMAYCEQHDIPVDFSKSKKKSPYSMDANL 185 Query: 179 LHISYEGGVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVEVEFFEGDPVAVNGERLSPAAL 238 LHISYEGG+LEDPWAE + M+R + PE APD P YVE+ + +GD VA++G+ + P + Sbjct: 186 LHISYEGGILEDPWAEAEEDMWRWSVSPEAAPDEPTYVELTYDKGDVVAIDGKPMKPHEV 245 Query: 239 LQRLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVLHQR 298 L+RLN++GG +G+GR+DIVENR+VGMKSRG YETPGGTI+ A RA+ES+TLDRE H + Sbjct: 246 LERLNKLGGDNGIGRLDIVENRYVGMKSRGCYETPGGTIMLRAHRAIESITLDREEAHLK 305 Query: 299 DMLSPKYAELVYYGFWYAPEREALQAYFDHVARSVTGVARLKLYKGNVYVVGRKAPKSLY 358 D L PKYA+++Y G+W++PER LQA D ++V GV R+KLYKGN VVGRK+ +SL+ Sbjct: 306 DELMPKYAKVIYNGYWWSPERRMLQAAIDETQKNVCGVVRMKLYKGNATVVGRKSEQSLF 365 Query: 359 RQDLVSF-DEAGGYDQKDAEGFIKIQALRLRVRA 391 + + +F D+AG Y+QKDAEGFIK+ ALRLR+ A Sbjct: 366 DESIATFEDDAGAYNQKDAEGFIKLNALRLRIAA 399 Lambda K H 0.319 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 524 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 406 Length adjustment: 31 Effective length of query: 369 Effective length of database: 375 Effective search space: 138375 Effective search space used: 138375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_086510012.1 BZY95_RS11225 (argininosuccinate synthase)
to HMM TIGR00032 (argG: argininosuccinate synthase (EC 6.3.4.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00032.hmm # target sequence database: /tmp/gapView.12120.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00032 [M=394] Accession: TIGR00032 Description: argG: argininosuccinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8e-146 472.3 0.0 9.2e-146 472.1 0.0 1.0 1 lcl|NCBI__GCF_002151265.1:WP_086510012.1 BZY95_RS11225 argininosuccinate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002151265.1:WP_086510012.1 BZY95_RS11225 argininosuccinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 472.1 0.0 9.2e-146 9.2e-146 1 389 [. 6 398 .. 6 403 .. 0.97 Alignments for each domain: == domain 1 score: 472.1 bits; conditional E-value: 9.2e-146 TIGR00032 1 kvvlaysGGlDtsvalklleek.gaeviavtvdvGqpeedldaieekalklGaekayviDareefvkdy 68 kvvlaysGGlDtsv++k+l+e ++ev+++t+d+Gq+ e+++ ++ ka +lG+++ y+ D reefv+dy lcl|NCBI__GCF_002151265.1:WP_086510012.1 6 KVVLAYSGGLDTSVIVKWLQETyNCEVVTFTADIGQG-EEVEPARAKAQALGVKEIYIEDLREEFVRDY 73 8*********************99************9.9****************************** PP TIGR00032 69 lfaaiqanavyegkYllstaLaRpliakklvevakkegaeavahGctgKGnDqvRFelsilllnpdlkv 137 + + +an++yeg+Yll+t++aRpliak+l+e+a++ ga+a++hG+tgKGnDqvRFe+ ++l+p +kv lcl|NCBI__GCF_002151265.1:WP_086510012.1 74 VYPMFRANTIYEGEYLLGTSIARPLIAKRLIEIANETGADAISHGATGKGNDQVRFEMGAYALKPGVKV 142 ********************************************************************* PP TIGR00032 138 iaPvreleli.ReeeieyaaekGievpve...kekaysiDenllgrsiEageLEdpsteppediyelvk 202 iaP+re++l+ Re++++y +++ i+v + k+++ys+D nll++s+E+g+LEdp++e ed++++ + lcl|NCBI__GCF_002151265.1:WP_086510012.1 143 IAPWREWDLTsREKLMAYCEQHDIPVDFSkskKKSPYSMDANLLHISYEGGILEDPWAEAEEDMWRWSV 211 *********99**************96651115679********************************* PP TIGR00032 203 dpiektedepevveieFekGvPvalngeslepvelilkaneiagkhGvGriDivEdRiiglKsReiYEa 271 +p++++ dep +ve++++kG va++g+ ++p e+++++n+++g +G+Gr+DivE+R++g+KsR++YE+ lcl|NCBI__GCF_002151265.1:WP_086510012.1 212 SPEAAP-DEPTYVELTYDKGDVVAIDGKPMKPHEVLERLNKLGGDNGIGRLDIVENRYVGMKSRGCYET 279 888887.************************************************************** PP TIGR00032 272 palllLikAhkdLetlvltkdvlefkeiveekyseliYkGlwfdplaealdalikktqervtGtvrvkl 340 p+ +++++Ah+++e+ +l+++++++k+ ky+++iY+G+w++p++ +l+a+i++tq++v G+vr+kl lcl|NCBI__GCF_002151265.1:WP_086510012.1 280 PGGTIMLRAHRAIESITLDREEAHLKDELMPKYAKVIYNGYWWSPERRMLQAAIDETQKNVCGVVRMKL 348 ********************************************************************* PP TIGR00032 341 fkGnaivigrkseyslYdeelvsfek.dkefdqkdaiGfikirglqikvy 389 +kGna+v+grkse+sl+de +++fe +++qkda+Gfik+++l+ ++ lcl|NCBI__GCF_002151265.1:WP_086510012.1 349 YKGNATVVGRKSEQSLFDESIATFEDdAGAYNQKDAEGFIKLNALRLRIA 398 *************************9445799*************98876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (394 nodes) Target sequences: 1 (406 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 7.21 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory