Align Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 (uncharacterized)
to candidate WP_086510656.1 BZY95_RS14680 aspartate carbamoyltransferase
Query= curated2:Q7V0J3 (308 letters) >NCBI__GCF_002151265.1:WP_086510656.1 Length = 342 Score = 109 bits (273), Expect = 8e-29 Identities = 100/325 (30%), Positives = 161/325 (49%), Gaps = 38/325 (11%) Query: 9 NKNFLSSLDITTDEVFHILDLSKKFK----NKKLNINLHNKVLGLIFDKSSTRTRVSFQV 64 +++ LS +T D V H++ ++ + + +++ L VLG +F ++STRTRVSF Sbjct: 2 SRHLLSVDSLTRDSVNHLMHVAARMEPIAQRRQVTRVLEGAVLGNLFFEASTRTRVSFHT 61 Query: 65 AMSRLGGTTIDLNPTT-SQIERGEPIKDTARVLSRYCDVIAIRTFNHADLEEYARWSTKP 123 A RLGG+ D T S + +GE + DT+RV+S YCD I +R + + E+A + P Sbjct: 62 AFCRLGGSVCDTTGFTFSSMAKGESLYDTSRVMSGYCDAIVMRHPDQGSVAEFAAATHVP 121 Query: 124 VINALTDL-EHPCQALADFLTIYEEF------LDFKDVVLTFIGD---GNNVANSLILCG 173 VIN EHP QAL DF TI +EF L V+LT GD G V + + L Sbjct: 122 VINGGDGPGEHPSQALLDFYTIDKEFTRLGKKLAGAHVLLT--GDLKYGRTVHSLIKLLS 179 Query: 174 ALLGVEVRIACPKGYE-PN---SMVINKAYEIYKNRNLLKITNDPDTAVLGANVLYTDVW 229 + + + P G E P+ +V ++ + I + +L D D V+YT Sbjct: 180 LYDPMRITLVAPPGLEMPDYLIDLVASRGHRIEQRTSLADDYADVD-------VVYT--- 229 Query: 230 SSMGEENQKAEKDKVFN---GFTIDNDLVSK-ADKEAIILHCLPAYRSKEITD---EVFE 282 + + +E AE + F+ FT+D + K ++ I++H LP E D ++ Sbjct: 230 TRIQKERFTAEMSEGFSLSRDFTVDRAFMDKRCGRDTIVMHPLPRDSRPEANDLDVDLNG 289 Query: 283 SKKNRIFDQAENRMHVQQALLSCLL 307 + IF Q +N + V+ A+ + LL Sbjct: 290 DPRLAIFRQTDNGIPVRMAIFATLL 314 Lambda K H 0.319 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 342 Length adjustment: 28 Effective length of query: 280 Effective length of database: 314 Effective search space: 87920 Effective search space used: 87920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory