Align Carbamoyl-phosphate synthase small chain; Carbamoyl-phosphate synthetase glutamine chain; EC 6.3.5.5 (characterized)
to candidate WP_086510468.1 BZY95_RS13635 carbamoyl-phosphate synthase small subunit
Query= SwissProt::P0A6F1 (382 letters) >NCBI__GCF_002151265.1:WP_086510468.1 Length = 386 Score = 529 bits (1362), Expect = e-155 Identities = 259/380 (68%), Positives = 299/380 (78%), Gaps = 5/380 (1%) Query: 3 KSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGN 62 + A+L LEDG+ FHG AIGA G GEVVFNT+MTGYQEILTD SY+RQIVTLTYPHIGN Sbjct: 8 RPAILALEDGSVFHGTAIGADGQTSGEVVFNTAMTGYQEILTDLSYTRQIVTLTYPHIGN 67 Query: 63 VGTNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLL 122 G N D ES + A GLVIRDLPLIASNFR+ + LS YLK N++ IADIDTR+LTR+L Sbjct: 68 TGVNAEDVESGSIAAAGLVIRDLPLIASNFRSEQSLSDYLKSQNVLGIADIDTRRLTRIL 127 Query: 123 REKGAQNGCIIAGDNPDAALALEKA----RAFPGLNGMDLAKEVTTAEAYSWTQGSWTLT 178 R+KGAQNG I+AG + A+E+A RAFPGL GMDLAKEV+ +AY W + W L Sbjct: 128 RDKGAQNGAILAGREAEGEDAVERALAAARAFPGLKGMDLAKEVSCKQAYEWNEAEWVLG 187 Query: 179 GGLPEAKKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFL 238 G +A E PFHVV YD+G K NILRML RGCRLT+VPAQT A DVL NPDGI L Sbjct: 188 QGNVDASGS-ERPFHVVVYDYGVKYNILRMLASRGCRLTVVPAQTPASDVLARNPDGILL 246 Query: 239 SNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNHPVK 298 +NGPGDPAPCDYAI AIQ+ LETD+PVFGICLGHQLLALA+GAKTVKM GHHG NHPV+ Sbjct: 247 ANGPGDPAPCDYAIKAIQEILETDVPVFGICLGHQLLALAAGAKTVKMNHGHHGANHPVQ 306 Query: 299 DVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASP 358 D++ VMIT+QNHGFAVDEA+LP N+R H+SLFDGTLQGI TD+PAFSFQGHPEASP Sbjct: 307 DLDSGHVMITSQNHGFAVDEASLPGNVRAIHRSLFDGTLQGIELTDRPAFSFQGHPEASP 366 Query: 359 GPHDAAPLFDHFIELIEQYR 378 GP D +PLFD F+ ++ + R Sbjct: 367 GPRDVSPLFDRFVTMMRERR 386 Lambda K H 0.318 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 540 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 386 Length adjustment: 30 Effective length of query: 352 Effective length of database: 356 Effective search space: 125312 Effective search space used: 125312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_086510468.1 BZY95_RS13635 (carbamoyl-phosphate synthase small subunit)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.13671.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-146 473.1 0.0 3e-146 472.9 0.0 1.0 1 lcl|NCBI__GCF_002151265.1:WP_086510468.1 BZY95_RS13635 carbamoyl-phosphat Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002151265.1:WP_086510468.1 BZY95_RS13635 carbamoyl-phosphate synthase small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 472.9 0.0 3e-146 3e-146 1 360 [. 10 383 .. 10 384 .. 0.95 Alignments for each domain: == domain 1 score: 472.9 bits; conditional E-value: 3e-146 TIGR01368 1 atlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneedaesk 69 a+l+ledG+vf+g+++ga++++ GevvFnT+mtGYqEiltD sY++qiv+ltyp+ign+gvn+ed+es lcl|NCBI__GCF_002151265.1:WP_086510468.1 10 AILALEDGSVFHGTAIGADGQTSGEVVFNTAMTGYQEILTDLSYTRQIVTLTYPHIGNTGVNAEDVESG 78 689****************************************************************** PP TIGR01368 70 kikvkglvvkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavistekse.... 134 +i ++glv+++l +sn+r+++sL+++lk++++ +i+++DTR l++ lR+kg+++++i + +++ lcl|NCBI__GCF_002151265.1:WP_086510468.1 79 SIAAAGLVIRDLPLIASNFRSEQSLSDYLKSQNVLGIADIDTRRLTRILRDKGAQNGAILAGREAeged 147 ***********************************************************9887666666 PP TIGR01368 135 .keelvekakespkvkevnlvkevstkeayeleq......k....akkegkklrvvvidlGvKenilre 192 e++ ++a++ p +k+++l+kevs+k+aye+++ + a+ +++ +vvv+d+GvK nilr+ lcl|NCBI__GCF_002151265.1:WP_086510468.1 148 aVERALAAARAFPGLKGMDLAKEVSCKQAYEWNEaewvlgQgnvdASGSERPFHVVVYDYGVKYNILRM 216 6778888899***********************97776661554345555559**************** PP TIGR01368 193 LvkrgvevtvvpadtsaeeikklnpdgillsnGPGdPaaveeaietvkklleakiPifGIclGhqllal 261 L++rg+++tvvpa+t+a+++ + npdgill+nGPGdPa +++ai+ ++++le+++P+fGIclGhqllal lcl|NCBI__GCF_002151265.1:WP_086510468.1 217 LASRGCRLTVVPAQTPASDVLARNPDGILLANGPGDPAPCDYAIKAIQEILETDVPVFGICLGHQLLAL 285 ********************************************************************* PP TIGR01368 262 algaktyklkfGhrGaNhpvkdlktgrveitsqNHgyavdeeslkeeelevthvnlnDgtveglehkel 330 a+gakt+k++ Gh+GaNhpv+dl++g+v+itsqNHg+avde+sl+ +++++ h++l+Dgt++g+e ++ lcl|NCBI__GCF_002151265.1:WP_086510468.1 286 AAGAKTVKMNHGHHGANHPVQDLDSGHVMITSQNHGFAVDEASLP-GNVRAIHRSLFDGTLQGIELTDR 353 *******************************************87.66********************* PP TIGR01368 331 pvfsvQyHPeaspGphdteylFdefvelik 360 p+fs Q HPeaspGp+d + lFd+fv++++ lcl|NCBI__GCF_002151265.1:WP_086510468.1 354 PAFSFQGHPEASPGPRDVSPLFDRFVTMMR 383 ***************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (386 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.09 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory