Align Glutamyl-tRNA(Gln) amidotransferase subunit A; Glu-ADT subunit A; EC 6.3.5.7 (uncharacterized)
to candidate WP_086511931.1 BZY95_RS21490 amidase
Query= curated2:Q72L58 (471 letters) >NCBI__GCF_002151265.1:WP_086511931.1 Length = 502 Score = 178 bits (451), Expect = 4e-49 Identities = 165/499 (33%), Positives = 230/499 (46%), Gaps = 66/499 (13%) Query: 10 VARGEVSPLEVAQAYLKRVQELDPGLGAFLSLN-ERLLEEAEAVDPGLPLAGLVVAVKDN 68 + RGEVS EV A ++ +P L A + ER EAE+VDP PLAG+ KD Sbjct: 18 IRRGEVSRGEVFAAACAAIERDNPHLRALVRTRFERARSEAESVDPEAPLAGVPTLTKDL 77 Query: 69 I-ATRGLRTTAGSRLLENFVPPYEATAVARLKALGALVLGKTNLDEFGMGSSTEHSAFFP 127 + A G GS L + P E+T VAR++ G +LG+T E G+ TE AF Sbjct: 78 LMALEGEPLAFGSAALAEWKAPVESTLVARVREAGLAILGQTATPELGLMGITEPRAFPH 137 Query: 128 TKNPFDPDRVPGGSSGGSAAALAADLAPLALGSDTGGSVRQPAAFCGVYGLKPTYGRVSR 187 NP++ + PGGSSGG+AAA+A L PLA+ D GGS+R PAA+CG++GLKP+ GRV + Sbjct: 138 PVNPWNAEHSPGGSSGGAAAAVAGGLVPLAMAGDGGGSIRIPAAYCGLFGLKPSRGRVPQ 197 Query: 188 ---FGLIAYASSLDQIGPMARSVRDLALLMDAVAGPDPLDATSLDLPPRFQEALEGPLPP 244 G + + ++ + RSVRD A L++A+ G D + F ALE P P Sbjct: 198 GPLHGEVWRGAVVEH--AVTRSVRDSAALLEAINGMDEGGPYPVPRERGFLAALERPPEP 255 Query: 245 LRLGV-VREALAGN-----SPGVERALEEALKVFRELGLSVREVSWPSLPQALA-AYYIL 297 LR+ V + E L+ P V A+E A + LG + P + LA AY L Sbjct: 256 LRIAVSLGEPLSKPLGTRLDPEVRLAVEGAARTLEGLGHHLEWADPPVDGERLANAYLTL 315 Query: 298 APAEASSNLARYDGTLYGRRAEGEEVE--GMMEATRALFGLEVKRRVLVGTFVLSSGYYE 355 +++LA + R G V + +TRA+ + + + V + L+ + Sbjct: 316 YLGHVTADLA------WISRETGVPVSRLDIEPSTRAI--ARLGQHLPVRDYELAKRDWN 367 Query: 356 AYYGRAQAFRRRLKAEAQALFREVDLLLLPTTPHPAFPFGARRDPLAMYR---------- 405 A AF RR D+LL+P T PA G P R Sbjct: 368 AAARAMGAFHRRF-----------DVLLMPVTAAPAPRLGELYPPAWQQRLMALLAIPGL 416 Query: 406 -------------------EDLYTVGANLTGLPALSFPAGFEGH-LPVGLQLLAPWGEDE 445 YT ANLTG PA+S P LPVG+Q++ G++ Sbjct: 417 PRLALKAGMLGQLARDALSRTPYTQLANLTGQPAMSLPLHVTPQGLPVGVQVVGSMGDER 476 Query: 446 RLLRAALAFE-EATARAHL 463 RLL A E E + HL Sbjct: 477 RLLALAAQLEAEVQWQRHL 495 Lambda K H 0.319 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 607 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 471 Length of database: 502 Length adjustment: 34 Effective length of query: 437 Effective length of database: 468 Effective search space: 204516 Effective search space used: 204516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory