Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate WP_086509326.1 BZY95_RS07485 3-deoxy-7-phosphoheptulonate synthase
Query= BRENDA::P00888 (356 letters) >NCBI__GCF_002151265.1:WP_086509326.1 Length = 369 Score = 338 bits (867), Expect = 1e-97 Identities = 172/330 (52%), Positives = 221/330 (66%), Gaps = 3/330 (0%) Query: 14 EQVLMTPEQLKAAFPLSLQQEAQIADSRKSISDIIAGRDPRLLVVCGPCSIHDPETALEY 73 E L TP +L+ PL+ ++A R++I DI+ G D R+LVV GPCSIHDP ALEY Sbjct: 36 EMTLPTPGELRRRLPLAPPVTERLAAQRRAIRDIVTGCDDRMLVVVGPCSIHDPLAALEY 95 Query: 74 ARRFKALAAEVSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDVEAGLQIARKLLLE 133 ARR LA +SD L VMRVY EKPRTTVGWKGL DP +DGS D+ GL ++R ++ E Sbjct: 96 ARRLAELAPRISDRLLPVMRVYVEKPRTTVGWKGLAYDPDLDGSGDMARGLHLSRHMMHE 155 Query: 134 LVNMGLPLATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMASGLSMPVGFKNGTDGS 193 + +GLP+ATE L P Y DL +W AIGARTTESQ HRE+ASGL VGFKN T G Sbjct: 156 IAALGLPVATEVLQPMLASYFDDLLAWVAIGARTTESQLHRELASGLEAAVGFKNATSGD 215 Query: 194 LATAINAMRAAAQPHRFVGINQAGQVALLQTQGNPDGHVILRGG-KAPNYSPADVAQCEK 252 + A++A+RAAA PH+ G+++ G+ AL +T GN HV+LRGG PN+ VA+ + Sbjct: 216 VGVAVDAIRAAAHPHQHFGLDEQGRPALRETTGNSYAHVVLRGGHHGPNHDSRSVAEARR 275 Query: 253 EMEQAGLRPSLMVDCSHGNSNKDYRRQPAVAESVVAQIKDGNRSIIGLMIESNIHEGNQS 312 +EQAGL LMVDCSH N+ KD+RRQ V VV Q G +++GLM+ES++ EG Q Sbjct: 276 ALEQAGLPARLMVDCSHANARKDHRRQGEVLRDVVTQRVQGETALMGLMLESHLEEGRQ- 334 Query: 313 SEQPRSEMKYGVSVTDACISWEMTDALLRE 342 E ++YGVSVTD C+ W+ T+ALL E Sbjct: 335 -ELAPGALRYGVSVTDPCLGWQATEALLLE 363 Lambda K H 0.316 0.131 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 381 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 369 Length adjustment: 29 Effective length of query: 327 Effective length of database: 340 Effective search space: 111180 Effective search space used: 111180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_086509326.1 BZY95_RS07485 (3-deoxy-7-phosphoheptulonate synthase)
to HMM TIGR00034 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00034.hmm # target sequence database: /tmp/gapView.4044.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00034 [M=342] Accession: TIGR00034 Description: aroFGH: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-135 437.5 0.0 1.6e-135 437.2 0.0 1.0 1 lcl|NCBI__GCF_002151265.1:WP_086509326.1 BZY95_RS07485 3-deoxy-7-phosphoh Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002151265.1:WP_086509326.1 BZY95_RS07485 3-deoxy-7-phosphoheptulonate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 437.2 0.0 1.6e-135 1.6e-135 10 337 .. 38 367 .. 30 369 .] 0.98 Alignments for each domain: == domain 1 score: 437.2 bits; conditional E-value: 1.6e-135 TIGR00034 10 elltPeelkakfpltekaaekvaksrkeiadilaGkddrllvviGPcsihdpeaaleyakrlkklaekl 78 l tP el+++ pl++ ++e++a +r++i di++G ddr+lvv+GPcsihdp aaleya+rl++la ++ lcl|NCBI__GCF_002151265.1:WP_086509326.1 38 TLPTPGELRRRLPLAPPVTERLAAQRRAIRDIVTGCDDRMLVVVGPCSIHDPLAALEYARRLAELAPRI 106 4679***************************************************************** PP TIGR00034 79 kddleivmrvyfekPrttvGWkGlindPdlnesfdvnkGlriarkllldlvelglplatelldtispqy 147 +d+l vmrvy+ekPrttvGWkGl dPdl++s d+ +Gl+++r+++ +++ lglp+ate+l+++ + y lcl|NCBI__GCF_002151265.1:WP_086509326.1 107 SDRLLPVMRVYVEKPRTTVGWKGLAYDPDLDGSGDMARGLHLSRHMMHEIAALGLPVATEVLQPMLASY 175 ********************************************************************* PP TIGR00034 148 ladllswgaiGarttesqvhrelasglslpvgfkngtdGslkvaidairaaaaehlflsvtkaGqvaiv 216 + dll+w aiGarttesq+hrelasgl +vgfkn+t G++ va+dairaaa++h ++ +++G+ a+ lcl|NCBI__GCF_002151265.1:WP_086509326.1 176 FDDLLAWVAIGARTTESQLHRELASGLEAAVGFKNATSGDVGVAVDAIRAAAHPHQHFGLDEQGRPALR 244 ********************************************************************* PP TIGR00034 217 etkGnedghiilrGGkk.pnydaedvaevkeelekaglkeelmidfshgnsnkdykrqlevaesvveqi 284 et+Gn+++h++lrGG++ pn+d+++vae+++ le+agl ++lm+d+sh+n++kd++rq ev ++vv q lcl|NCBI__GCF_002151265.1:WP_086509326.1 245 ETTGNSYAHVVLRGGHHgPNHDSRSVAEARRALEQAGLPARLMVDCSHANARKDHRRQGEVLRDVVTQR 313 ********************************************************************* PP TIGR00034 285 aeGekaiiGvmiesnleeGnqsl.keelkyGksvtdacigwedteallrklaea 337 +Ge+a++G+m+es+leeG+q+l +l yG+svtd c+gw+ teall + a+ lcl|NCBI__GCF_002151265.1:WP_086509326.1 314 VQGETALMGLMLESHLEEGRQELaPGALRYGVSVTDPCLGWQATEALLLEAADR 367 ***********************7789********************9888775 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (342 nodes) Target sequences: 1 (369 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.24 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory