Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate WP_086508787.1 BZY95_RS04510 O-succinylhomoserine sulfhydrylase
Query= BRENDA::Q5H4T8 (397 letters) >NCBI__GCF_002151265.1:WP_086508787.1 Length = 398 Score = 313 bits (803), Expect = 4e-90 Identities = 176/393 (44%), Positives = 254/393 (64%), Gaps = 17/393 (4%) Query: 12 DRALSLATLAIHGG--QSPDPSTGAVMPPIYATSTYAQSSP--------GEHQGFEYSRT 61 D A +L TLAI G ++ + G PI+ TS++ S GE +G YSR Sbjct: 8 DPAWALETLAIRAGHQRTHEQEHGE---PIFPTSSFVYGSAAEAARKFGGEERGNVYSRF 64 Query: 62 HNPTRFAYERCVAALEGGTRAFAFASGMAAT-STVMELLDAGSHVVAMDDLYGGTFRLFE 120 NPT +ER +AALEGG R A +SGMAA STV+ LL AG +VA L+G T LF+ Sbjct: 65 TNPTVHTFERRLAALEGGERCVATSSGMAAILSTVLALLQAGDEIVASRSLFGSTVSLFD 124 Query: 121 RVRRRTAGLDFSFVDLTDPAAFKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGL 180 + + G+ +V+L+D AA++AAI T++++ ETP+NP+ ++VDIAA+A IA +H Sbjct: 125 KYFGKL-GITTRYVELSDLAAWEAAITPHTRLLFAETPSNPLSEVVDIAALAEIAHRHQA 183 Query: 181 LTVVDNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVVGDNAELAEQMAFLQN 240 L +DN F +P LQ+PL+LGADLV+HSATKYL+G VGG AVVG + EL E ++ Sbjct: 184 LLAIDNCFLTPALQQPLALGADLVIHSATKYLDGQGRAVGG-AVVGRDKELEEVFGVVR- 241 Query: 241 SIGGVQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASHPQHV 300 + G PF++++ +GL+TL LRMRAHC NA ALA+WL+ HPA+ +V Y GL HPQH Sbjct: 242 TCGPCLSPFNAWIFTKGLETLSLRMRAHCGNAQALAEWLQVHPAVARVHYSGLPDHPQHE 301 Query: 301 LAKRQMSGFGGIVSIVLKGGFDAAKRFCEKTELFTLAESLGGVESLVNHPAVMTHASIPV 360 LA RQ +G+G ++ +KGG +AA + T + ++ +LG V++ + HPA TH + Sbjct: 302 LAGRQQAGYGAVLGFEVKGGREAAWSVIDATRMLSITGNLGDVKTTITHPATTTHGRLSP 361 Query: 361 ARREQLGISDALVRLSVGIEDLGDLRGDLERAL 393 A+++ GIS+ L+R++VG+E + D+R DL R L Sbjct: 362 AQKDAAGISEGLIRVAVGLESIEDIRLDLARGL 394 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 447 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 398 Length adjustment: 31 Effective length of query: 366 Effective length of database: 367 Effective search space: 134322 Effective search space used: 134322 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory