Align L-serine/homoserine O-acetyltransferase; Homoserine O-trans-acetylase; EC 2.3.1.30; EC 2.3.1.31 (characterized)
to candidate WP_086510438.1 BZY95_RS13465 homoserine O-acetyltransferase
Query= SwissProt::D2Z028 (374 letters) >NCBI__GCF_002151265.1:WP_086510438.1 Length = 385 Score = 231 bits (590), Expect = 2e-65 Identities = 139/364 (38%), Positives = 199/364 (54%), Gaps = 13/364 (3%) Query: 16 DGFAMRRGGALYGARIAYETFGSLNAARDNAVLVLTGLSPDAHAASR--PDDPTPGWWEA 73 D A+ G L + YET+G+LNA R NAVL+ LS HAA D+ PGWW+A Sbjct: 21 DPLALACGRTLPAYDLVYETYGTLNAERSNAVLICHALSGHHHAAGYHDADERKPGWWDA 80 Query: 74 MVGPGKPVDTDLWHVICVNSLGSCKGSTGPASTDPRTGEPYRLSFPELSIEDIADAAAHT 133 +GPGK +DT+ + V+ +N+LG C GSTGP ST+P TG + FP +++ D + A Sbjct: 81 HIGPGKSIDTNRFFVVSLNNLGGCHGSTGPISTNPATGRQWGPDFPMVTVSDWVHSQARL 140 Query: 134 VRALGISRLACVVGASMGGMSALALLARHPELARTHISLSGAVHALPFSIAVRSLQREAI 193 LGI R A +G S+GGM L +PE + ++ +IA + R+AI Sbjct: 141 ADRLGIERFAAAIGGSLGGMQVLQWTRLYPERVANAVIIAATPKLSAQNIAFNEVARQAI 200 Query: 194 RSDPGWLQGHYDE-GEGPRRGMLTARKLGMMTYRSAQEWDCRFGRTRIGERRRADQGRFG 252 RSDP + G Y E G PRRG+ AR +G +TY S +FGR R++ FG Sbjct: 201 RSDPDFHDGWYAEHGTAPRRGLKLARMVGHITYLSEDAMGSKFGRD-----LRSEDLNFG 255 Query: 253 --PEFEVESYLDFHAQRFADRFDPNSYLYLSHAMDQFDLGDGGGGGGGAPGALSRMRVER 310 EF+VESYL + F+ FD N+YL ++ A+D FD GG A++ + Sbjct: 256 YDVEFQVESYLRYQGDTFSTAFDANTYLLMTKALDYFD--PAAEHGGVLAEAVAPCQ-GP 312 Query: 311 ALVMGARTDILFPLSQQQEIADGLSAGGADVSFLPVDTPAGHDAFLVDIERFGPPVAKFL 370 LV+ +D FP S+ +E+A+ L G VS++ +D+P GHDAFL+ R+ A F+ Sbjct: 313 FLVVSFTSDWRFPPSRSRELANALIRAGKRVSYVNIDSPHGHDAFLLPEPRYQAVFAAFM 372 Query: 371 AIVA 374 + VA Sbjct: 373 SRVA 376 Lambda K H 0.321 0.138 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 448 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 385 Length adjustment: 30 Effective length of query: 344 Effective length of database: 355 Effective search space: 122120 Effective search space used: 122120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory