Align alanine-glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate WP_086510803.1 BZY95_RS15480 4-aminobutyrate--2-oxoglutarate transaminase
Query= BRENDA::Q3UEG6 (513 letters) >NCBI__GCF_002151265.1:WP_086510803.1 Length = 430 Score = 189 bits (479), Expect = 2e-52 Identities = 133/422 (31%), Positives = 210/422 (49%), Gaps = 31/422 (7%) Query: 95 LFDSEGNRYLDFFSGIVTVSVGHCHPKVSAVAKKQIDRLWHT-SSVFFHSPMHEYAEKLS 153 ++D++GNR +DF GI +++GH HPKV K Q+D++ HT +V + + AEKLS Sbjct: 34 IWDADGNRIIDFAGGIGVLNIGHRHPKVVEAVKAQLDKVMHTCQTVMPYEGYVKVAEKLS 93 Query: 154 ALLP-EPLKVIFLVNSGSEANDLAMVMARAHSNHTDIISFRGAYHGCSPYTLGLTN-VGI 211 + P + L NSG+EA + A+ +ARA + ++I F G YHG + T+ + V Sbjct: 94 QVTPVRGHAKVMLANSGAEALENAVKIARAATGKNNVICFDGGYHGRTFMTMAMNGKVAP 153 Query: 212 YKMEVPGGIGCQSTMCPDVFRGPWGGIHCRDSPVQTVRDCSCAPDCCQAKERYIEQFKDT 271 Y + TM +VFR P+ PV P +++ I K Sbjct: 154 YASDF-------GTMPGNVFRAPY--------PV---------PYHGVSEDEAIRGLKMA 189 Query: 272 LNTSV-ATSIAGFFAEPIQGVNGVVQYPKEFLKEAFALVRERGGVCIADEVQTGFGRLGS 330 + T A EP+ G G P FLK + E G + I DEVQ+GFGR G Sbjct: 190 IKTDANPRDTAAIVLEPVLGEGGFYPAPASFLKAIREICDEHGMLMIVDEVQSGFGRTGK 249 Query: 331 HFWGFQTHDVLPDIVTMAKGIGNGFPMAAVVTTPEIAKSLAKRLLHFSTFGGNPLACAIG 390 F + V PDI+TMAK + +G P++AVV T ++ + L T+ GNPL+CA Sbjct: 250 LF-AIEHSGVEPDIITMAKSMADGMPISAVVGTDKVMDASGPNSLG-GTYTGNPLSCAAT 307 Query: 391 SAVLEVIEEENLQRNSQEVGTYMLLKFAKLRDEFDIVGDVRGKGLMVGIEMVQDKISRQP 450 AVL+V EEEN+ S +G + +FA+ + +FD V + R G M +++V DK P Sbjct: 308 LAVLDVFEEENILEKSMALGDKLAKRFAQWQRDFDCVDNARNMGAMAALDLVTDKAKHTP 367 Query: 451 LPKTEVNQIHEDCKDMGLLVGRGGNFSQTFRIVPPMCVTKMEVDFAYEVFRAALIQHMER 510 + + ++ GL++ G + T R + P+ + ++ ++ AAL + + Sbjct: 368 -DADLAAALCKKAREKGLILLSCGLYGNTIRFLMPVTIEDEILEEGLDIVEAALTELVGS 426 Query: 511 RA 512 +A Sbjct: 427 KA 428 Lambda K H 0.323 0.137 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 492 Number of extensions: 29 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 513 Length of database: 430 Length adjustment: 33 Effective length of query: 480 Effective length of database: 397 Effective search space: 190560 Effective search space used: 190560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory