Align asparagine-oxo-acid transaminase (EC 2.6.1.14); alanine-glyoxylate transaminase (EC 2.6.1.44); serine-glyoxylate transaminase (EC 2.6.1.45) (characterized)
to candidate WP_086511813.1 BZY95_RS20880 aminotransferase class V-fold PLP-dependent enzyme
Query= BRENDA::Q56YA5 (401 letters) >NCBI__GCF_002151265.1:WP_086511813.1 Length = 406 Score = 344 bits (883), Expect = 2e-99 Identities = 175/386 (45%), Positives = 246/386 (63%), Gaps = 7/386 (1%) Query: 8 GRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFLFPT 67 GRH L +PGP +P+ ++RAM+ D+R P AL LL +K++FKT G ++P Sbjct: 10 GRHFLQIPGPSPVPDRILRAMSLPTIDHRGPEFGALGLELLAKLKQVFKT-EGPVMIYPA 68 Query: 68 TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVE----SDWGQGANL 123 +GTGAWE+AL N LSPGDR++ + G F+ LW RL + + W QG Sbjct: 69 SGTGAWEAALANVLSPGDRVLMYETGHFAALWHKMALRLQLEPEFIGLPGYEGWRQGVQA 128 Query: 124 QVLASKLSQDENHTIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICAL 183 ++ ++L +D H +KA+C+VHNET+TGVT+DI+AVR +D HPALLLVD +S + + Sbjct: 129 DMIEARLREDAEHRLKAVCVVHNETSTGVTSDIAAVRRAIDAAGHPALLLVDTISGLASA 188 Query: 184 DFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKL 243 D+R DEWGVDV ++GSQK L LP G+ S KA+ A++ S + F+ W++ L+ + Sbjct: 189 DYRHDEWGVDVTISGSQKGLMLPPGISFNALSDKAIAASRESTMPRSFWAWDEILEANRN 248 Query: 244 GTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQKEEW 303 G YWPYTPS LLYGL ALD++ +EGLE++ ARH R R AVEAWGL+ Q Sbjct: 249 G-YWPYTPSTNLLYGLNEALDMLLDEGLEHVFARHQRWAAGVRTAVEAWGLEIQCQDPAL 307 Query: 304 ISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCL 363 S +T V++P +D + + ++R++LSLG+GL K GK+FRIGHLG+ N+L L+ L Sbjct: 308 YSPVLTGVVMPDGVDADAVRKIIYERFDLSLGMGLGKAKGKMFRIGHLGDCNDLTLIATL 367 Query: 364 AGVEMILKDVGYPVVMGSGVAAASTY 389 G E +K G P+ GSGVAAA Y Sbjct: 368 GGCEAGMKLCGVPLA-GSGVAAALEY 392 Lambda K H 0.320 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 451 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 406 Length adjustment: 31 Effective length of query: 370 Effective length of database: 375 Effective search space: 138750 Effective search space used: 138750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory