Align Histidinol-phosphate aminotransferase; EC 2.6.1.9; Imidazole acetol-phosphate transaminase (uncharacterized)
to candidate WP_086508963.1 BZY95_RS05445 putative C-S lyase
Query= curated2:Q1AY33 (351 letters) >NCBI__GCF_002151265.1:WP_086508963.1 Length = 392 Score = 52.4 bits (124), Expect = 2e-11 Identities = 76/273 (27%), Positives = 113/273 (41%), Gaps = 33/273 (12%) Query: 99 LMLVERPGEVLFPWPTFTLYPSIAGTLGLRARRVPLTEEH------RVKPEALLSAVTGE 152 L L E VL P + + +A G +++V L E R+ AL +A+T E Sbjct: 105 LALTEPGDGVLTLTPIYPPFLKVAERTGRLSQQVALAEPAGPGEPWRLDLAALEAAITPE 164 Query: 153 TRAVILCNPNNPTGTHLTLEEVSALADALP-EDVLLILDEAYQEFVADP-AYHGSHALAL 210 TR ++ C P+NPTG EE++ LA + D+L++ DE + + + D A H A A Sbjct: 165 TRLLLWCQPHNPTGRVWRHEELAGLAALIERHDLLVVSDELHCDLLLDEGARHRPLAAAF 224 Query: 211 ERPNVAVARTF--SKAHGLAGFRVGYGLAS----REIADYAERVRFPFSVNLAAQVAA-- 262 + + SK LAG + R+ A R P VN+ VAA Sbjct: 225 PELAARIITLWAPSKTFNLAGLTAACAVIPNGELRQRFAAAARGLLP-DVNVLGLVAAEV 283 Query: 263 -----TASMQAREKIRARAEFVIRER--------ERVERAFREAGLNYVHSQGNFVLVET 309 A QA K V+ ER V A A L+ ++G + Sbjct: 284 AYGQCNAWRQALLKTLRGHRQVLIERVAQWPGVGMSVPEATYLAWLDMRRAEG-LAQRQG 342 Query: 310 SP--ALFERAGVLVREGDPLGYPGWSRVTIGNT 340 SP L + A V + +G G+PG+ R+ G T Sbjct: 343 SPQQLLLQEAKVALSDGADFGWPGFVRLNFGTT 375 Lambda K H 0.317 0.133 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 351 Length of database: 392 Length adjustment: 30 Effective length of query: 321 Effective length of database: 362 Effective search space: 116202 Effective search space used: 116202 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory