Align Histidinol dehydrogenase; HDH; EC 1.1.1.23 (uncharacterized)
to candidate WP_086508840.1 BZY95_RS04815 histidinol dehydrogenase
Query= curated2:Q9RH05 (430 letters) >NCBI__GCF_002151265.1:WP_086508840.1 Length = 436 Score = 291 bits (745), Expect = 3e-83 Identities = 165/413 (39%), Positives = 249/413 (60%), Gaps = 5/413 (1%) Query: 21 DERRESEGDVSRDVSAIIADVKKRGDVAIAELTQKFDRHDLNKGGWQLTQEEIKKACDSL 80 + R E++ V V + ++ RGD A+ EL++KFDR + ++L+Q EI++A L Sbjct: 12 EARAEADRKVRETVEQTLQAIETRGDEAVRELSEKFDRW--SPATFRLSQAEIERAISEL 69 Query: 81 PSELMDALKLAATRIRYCHENQLP--ESSEMTDAAGVRMGVRWQAVEAAGLYVPGGRAAY 138 ++ +D ++ A +IR E QL + E+ GV +G + V + G YVPGG Sbjct: 70 TAQELDDIRFAQAQIRRFAEAQLASMQDVEVETRPGVVLGHKHIPVNSVGCYVPGGAYPM 129 Query: 139 CSSVLMNAVPAKVAGVKRLVMVTPTPDGFVNPAVIAAAVISEVDEIWKIGGAQAVAALAL 198 +S M+ + AKVAGVKR++ P G +PA++AA ++ DEI +GG QAV A+A+ Sbjct: 130 VASAHMSVLTAKVAGVKRVIAAAPPYQGKPHPAIVAAMHLAGADEILVLGGVQAVGAMAI 189 Query: 199 GTEKIKPVDVVVGPGNAWVAEAKRQLYGQVGIDMVAGPSEIVVVADKDNDPEWLAADLLS 258 GTE I+ VD++VGPGNA+VAEAKRQL+G+VGID+ AGP+E +V+AD+ D A DLL Sbjct: 190 GTESIEAVDMLVGPGNAFVAEAKRQLFGRVGIDLFAGPTETLVIADETVDGLLCATDLLG 249 Query: 259 QAEHDPTSQSILISDSEDLIEKTIEAVGRRLEKLETQKVARESWDKHGATILVQSLDEAP 318 QAEH PTS + L+++SE L + T+ A+ L KL T ++AR++W+ +G I+ S +E Sbjct: 250 QAEHGPTSPAALLTNSEALAKATLTAIDELLAKLPTAEIARQAWNDYGEVIVCDSHEEML 309 Query: 319 ALVDRLAPEHLELAVADPDALFANVHHSGSVFLGRYTPEAIGDYVGGPNHVLPTGRRARF 378 + D +A EH+++ DP+ + + G++FLG T A GD V G NH LPT + AR+ Sbjct: 310 QVADEMAYEHVQVMTEDPNLYLDRLTNYGALFLGPRTNVAYGDKVIGTNHTLPTRKAARY 369 Query: 379 SSGLSVIDFMKRTTYLN-CSQEALSKIGPAAVTLAKAEGLPAHAESVISRLNK 430 + GL V F+K TY + EA ++IG L EG H E R+ + Sbjct: 370 TGGLWVGKFLKTCTYQKVLTDEASAEIGSYCSRLCALEGFAGHGEQANERVRR 422 Lambda K H 0.316 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 439 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 430 Length of database: 436 Length adjustment: 32 Effective length of query: 398 Effective length of database: 404 Effective search space: 160792 Effective search space used: 160792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
Align candidate WP_086508840.1 BZY95_RS04815 (histidinol dehydrogenase)
to HMM TIGR00069 (hisD: histidinol dehydrogenase (EC 1.1.1.23))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00069.hmm # target sequence database: /tmp/gapView.32257.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00069 [M=393] Accession: TIGR00069 Description: hisD: histidinol dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.1e-139 449.1 0.4 9.5e-139 448.9 0.4 1.0 1 lcl|NCBI__GCF_002151265.1:WP_086508840.1 BZY95_RS04815 histidinol dehydro Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002151265.1:WP_086508840.1 BZY95_RS04815 histidinol dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 448.9 0.4 9.5e-139 9.5e-139 1 393 [] 25 419 .. 25 419 .. 0.98 Alignments for each domain: == domain 1 score: 448.9 bits; conditional E-value: 9.5e-139 TIGR00069 1 vkeiiedvrkeGdeAlleytekfdkvkleslrvseeeleealeavdeelkealelaaeniekfhekqlp 69 v++ +++++++GdeA++e++ekfd+++++++r+s++e+e+a ++++++ ++++ a+++i++f+e+ql+ lcl|NCBI__GCF_002151265.1:WP_086508840.1 25 VEQTLQAIETRGDEAVRELSEKFDRWSPATFRLSQAEIERAISELTAQELDDIRFAQAQIRRFAEAQLA 93 788899*************************************************************97 PP TIGR00069 70 es..veveteegvllgqkvrplervglYvPgGkaaypStvlmtavpAkvAgvkeivvvtPpkkdgkvnp 136 + vevet++gv+lg+k p+++vg+YvPgG +++++++ m +++AkvAgvk++++++Pp +gk +p lcl|NCBI__GCF_002151265.1:WP_086508840.1 94 SMqdVEVETRPGVVLGHKHIPVNSVGCYVPGGAYPMVASAHMSVLTAKVAGVKRVIAAAPPY-QGKPHP 161 64459********************************************************6.9***** PP TIGR00069 137 avlaaakllgvdevykvGGaqaiaalayGtetvpkvdkivGPGniyVtaAKklvfgevgidmiaGPsEv 205 a++aa++l+g+de++ +GG+qa++a+a Gte++++vd++vGPGn++V++AK+++fg+vgid++aGP+E lcl|NCBI__GCF_002151265.1:WP_086508840.1 162 AIVAAMHLAGADEILVLGGVQAVGAMAIGTESIEAVDMLVGPGNAFVAEAKRQLFGRVGIDLFAGPTET 230 ********************************************************************* PP TIGR00069 206 lviadesanpelvaaDllsqaEHdedaqailvttseelaekveeeveeqleelerkeiaekslekngai 274 lviade+ + l+a+Dll qaEH++++ a+l+t+se+la+++ ++++e l++l+++eia+++++++g++ lcl|NCBI__GCF_002151265.1:WP_086508840.1 231 LVIADETVDGLLCATDLLGQAEHGPTSPAALLTNSEALAKATLTAIDELLAKLPTAEIARQAWNDYGEV 299 ********************************************************************* PP TIGR00069 275 ilvddleealelsneyApEHLelqtkdpeellkkiknaGsvflGeytpealgdyvaGpnhvLPTsgtAr 343 i++d+ ee+l++++e+A EH++++t+dp+ +l++++n+G++flG+ t +a+gd+v G+nh+LPT ++Ar lcl|NCBI__GCF_002151265.1:WP_086508840.1 300 IVCDSHEEMLQVADEMAYEHVQVMTEDPNLYLDRLTNYGALFLGPRTNVAYGDKVIGTNHTLPTRKAAR 368 ********************************************************************* PP TIGR00069 344 fasglsvedFlkrisvqel.skealeelaeaveklaeaEgLeaHaeavevR 393 +++gl+v +Flk++++q++ + ea +e+++ +++l+++Eg++ H e ++ R lcl|NCBI__GCF_002151265.1:WP_086508840.1 369 YTGGLWVGKFLKTCTYQKVlTDEASAEIGSYCSRLCALEGFAGHGEQANER 419 *****************963788999*******************998776 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (393 nodes) Target sequences: 1 (436 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.25 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory