Align histidinol dehydrogenase (EC 1.1.1.23) (characterized)
to candidate WP_086509840.1 BZY95_RS10280 histidinol dehydrogenase
Query= BRENDA::Q8G2R2 (430 letters) >NCBI__GCF_002151265.1:WP_086509840.1 Length = 441 Score = 392 bits (1006), Expect = e-113 Identities = 208/421 (49%), Positives = 281/421 (66%), Gaps = 1/421 (0%) Query: 9 DPDFEQKFAAFLSGKREVSEDVDRAVREIVDRVRREGDSALLDYSRRFDRIDLEKTGIAV 68 D DF+ + A L+ + +V V EI+ V+ GD+AL++Y++RFDR+ + Sbjct: 18 DGDFDARLDALLAWEGVSDAEVQERVAEIIAAVKVRGDAALVEYTQRFDRLAVGSMAELT 77 Query: 69 TEAE-IDAAFDAAPASTVEALKLARDRIEKHHARQLPKDDRYTDALGVELGSRWTAIEAV 127 A+ ++ A+ P +AL A +RI +H RQ P+ YT+A G LG + T ++ Sbjct: 78 LGADRLEQAYRGLPEQQRDALAQAAERIRLYHERQKPESWSYTEADGSVLGQQVTPLDRA 137 Query: 128 GLYVPGGTASYPSSVLMNAMPAKVAGVDRIVMVVPAPDGNLNPLVLVAARLAGVSEIYRV 187 G+YVPGG A+YPSSVLMNA+PA VAGV IVMVVP PDG LN LVL AA LAGV ++ + Sbjct: 138 GIYVPGGKAAYPSSVLMNAIPAHVAGVREIVMVVPTPDGVLNELVLAAAHLAGVDHVFTI 197 Query: 188 GGAQAIAALAYGTETIRPVAKIVGPGNAYVAAAKRIVFGTVGIDMIAGPSEVLIVADKDN 247 GGAQA+AALAYGTE++ V KIVGPGN YVA AKR VFG VGIDMIAGPSE+L+V+D Sbjct: 198 GGAQAVAALAYGTESVPRVDKIVGPGNIYVATAKRAVFGQVGIDMIAGPSEILVVSDGGT 257 Query: 248 NPDWIAADLLAQAEHDTAAQSILMTNDEAFAHAVEEAVERQLHTLARTETASASWRDFGA 307 +PDW+A DL +QAEHD AQ++L++ DE+ VE ++ R L TL R S GA Sbjct: 258 DPDWLAMDLFSQAEHDEDAQALLVSWDESHLDRVEASIARLLPTLEREAIVRESLARRGA 317 Query: 308 VILVKDFEDAIPLANRIAAEHLEIAVADAEAFVPRIRNAGSIFIGGYTPEVIGDYVGGCN 367 +I +D ++A+ L NRIA EHLE+++A+ EA +P++R+AG+IF+G YT E +GDY G N Sbjct: 318 LIHCRDRDEAVQLINRIAPEHLELSLAEPEAMLPQVRHAGAIFMGRYTAEALGDYCAGPN 377 Query: 368 HVLPTARSARFSSGLSVLDYMKRTSLLKLGSEQLRALGPAAIEIARAEGLDAHAQSVAIR 427 HVLPT+ +ARFSS L V D+ KR+S++ LG A +AR E L AHA+S R Sbjct: 378 HVLPTSGTARFSSPLGVYDFQKRSSIIHCSEAGASTLGRVASVLARGESLTAHARSAEYR 437 Query: 428 L 428 + Sbjct: 438 I 438 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 518 Number of extensions: 25 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 430 Length of database: 441 Length adjustment: 32 Effective length of query: 398 Effective length of database: 409 Effective search space: 162782 Effective search space used: 162782 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate WP_086509840.1 BZY95_RS10280 (histidinol dehydrogenase)
to HMM TIGR00069 (hisD: histidinol dehydrogenase (EC 1.1.1.23))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00069.hmm # target sequence database: /tmp/gapView.26348.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00069 [M=393] Accession: TIGR00069 Description: hisD: histidinol dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.6e-165 534.5 0.1 1.1e-164 534.3 0.1 1.0 1 lcl|NCBI__GCF_002151265.1:WP_086509840.1 BZY95_RS10280 histidinol dehydro Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002151265.1:WP_086509840.1 BZY95_RS10280 histidinol dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 534.3 0.1 1.1e-164 1.1e-164 1 393 [] 43 437 .. 43 437 .. 0.99 Alignments for each domain: == domain 1 score: 534.3 bits; conditional E-value: 1.1e-164 TIGR00069 1 vkeiiedvrkeGdeAlleytekfdkv...kleslrvseeeleealeavdeelkealelaaeniekfhek 66 v+eii++v+ +Gd+Al+eyt++fd++ ++++l++ +++le+a++ ++e+ ++al++aae+i+ +he+ lcl|NCBI__GCF_002151265.1:WP_086509840.1 43 VAEIIAAVKVRGDAALVEYTQRFDRLavgSMAELTLGADRLEQAYRGLPEQQRDALAQAAERIRLYHER 111 789**********************97888999************************************ PP TIGR00069 67 qlpesveveteegvllgqkvrplervglYvPgGkaaypStvlmtavpAkvAgvkeivvvtPpkkdgkvn 135 q+pes+++++++g++lgq+v+pl+r+g+YvPgGkaaypS+vlm+a+pA+vAgv+eiv+v P+ dg +n lcl|NCBI__GCF_002151265.1:WP_086509840.1 112 QKPESWSYTEADGSVLGQQVTPLDRAGIYVPGGKAAYPSSVLMNAIPAHVAGVREIVMVVPTP-DGVLN 179 **************************************************************6.***** PP TIGR00069 136 pavlaaakllgvdevykvGGaqaiaalayGtetvpkvdkivGPGniyVtaAKklvfgevgidmiaGPsE 204 + vlaaa+l+gvd+v+++GGaqa+aalayGte+vp+vdkivGPGniyV++AK+ vfg+vgidmiaGPsE lcl|NCBI__GCF_002151265.1:WP_086509840.1 180 ELVLAAAHLAGVDHVFTIGGAQAVAALAYGTESVPRVDKIVGPGNIYVATAKRAVFGQVGIDMIAGPSE 248 ********************************************************************* PP TIGR00069 205 vlviadesanpelvaaDllsqaEHdedaqailvttseelaekveeeveeqleelerkeiaeksleknga 273 +lv++d ++p+++a+Dl+sqaEHdedaqa+lv+ +e+ +++ve+++++ l +ler+ i+++sl+++ga lcl|NCBI__GCF_002151265.1:WP_086509840.1 249 ILVVSDGGTDPDWLAMDLFSQAEHDEDAQALLVSWDESHLDRVEASIARLLPTLEREAIVRESLARRGA 317 ********************************************************************* PP TIGR00069 274 iilvddleealelsneyApEHLelqtkdpeellkkiknaGsvflGeytpealgdyvaGpnhvLPTsgtA 342 +i ++d +ea++l+n++ApEHLel ++pe++l+++++aG++f+G+yt+ealgdy+aGpnhvLPTsgtA lcl|NCBI__GCF_002151265.1:WP_086509840.1 318 LIHCRDRDEAVQLINRIAPEHLELSLAEPEAMLPQVRHAGAIFMGRYTAEALGDYCAGPNHVLPTSGTA 386 ********************************************************************* PP TIGR00069 343 rfasglsvedFlkrisvqelskealeelaeaveklaeaEgLeaHaeavevR 393 rf+s+l+v+dF+kr+s++++s++++++l++ ++ la+ E L+aHa+++e R lcl|NCBI__GCF_002151265.1:WP_086509840.1 387 RFSSPLGVYDFQKRSSIIHCSEAGASTLGRVASVLARGESLTAHARSAEYR 437 ***********************************************9988 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (393 nodes) Target sequences: 1 (441 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 7.95 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory