Align ATP phosphoribosyltransferase (EC 2.4.2.17) (characterized)
to candidate WP_010629168.1 BZY95_RS10285 ATP phosphoribosyltransferase
Query= reanno::Putida:PP_0965 (211 letters) >NCBI__GCF_002151265.1:WP_010629168.1 Length = 220 Score = 295 bits (755), Expect = 4e-85 Identities = 147/207 (71%), Positives = 179/207 (86%) Query: 2 LTIALSKGRILDDTLPLLAEAGIVPTENPDKSRKLIIPTTQDDVRLLIVRATDVPTYVEH 61 L +ALSKGRILD+TLPLLA+AGIVP E+ KSRKL+ T DDV+L+I+RATDVPTYV+ Sbjct: 5 LILALSKGRILDETLPLLADAGIVPAEDLSKSRKLLFDTNLDDVKLVIIRATDVPTYVQM 64 Query: 62 GAADLGVAGKDVLMEYGGQGLYEPLDLQIAQCKLMTAGVVGAAEPKGRLRVATKFVNVAK 121 GAADLGVAGKDVL+E+G +GLYEPLDL+IA+CKLMTAG+ GA + R RVATKFVNVA+ Sbjct: 65 GAADLGVAGKDVLLEHGAEGLYEPLDLEIAKCKLMTAGIDGAKPARARRRVATKFVNVAR 124 Query: 122 RYYAEQGRQVDIIKLYGSMELAPLINLADKIIDVVDTGNTLRANGLEPQELIATISSRLV 181 RYYAEQG Q ++IKLYG+MELAPL+NLAD+I+D+VDTGNTLRANG+ P+ELIA IS+RLV Sbjct: 125 RYYAEQGIQAEVIKLYGAMELAPLMNLADEIVDIVDTGNTLRANGMSPRELIAPISTRLV 184 Query: 182 VNKASMKMQHARIQSLIDTLRAAVESR 208 VNKA+M M+H R++ L+ L AVE R Sbjct: 185 VNKAAMTMKHERLKPLLARLSQAVERR 211 Lambda K H 0.318 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 211 Length of database: 220 Length adjustment: 22 Effective length of query: 189 Effective length of database: 198 Effective search space: 37422 Effective search space used: 37422 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
Align candidate WP_010629168.1 BZY95_RS10285 (ATP phosphoribosyltransferase)
to HMM TIGR00070 (hisG: ATP phosphoribosyltransferase (EC 2.4.2.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00070.hmm # target sequence database: /tmp/gapView.11543.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00070 [M=183] Accession: TIGR00070 Description: hisG: ATP phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-56 175.5 0.1 6.1e-56 175.3 0.1 1.1 1 lcl|NCBI__GCF_002151265.1:WP_010629168.1 BZY95_RS10285 ATP phosphoribosyl Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002151265.1:WP_010629168.1 BZY95_RS10285 ATP phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 175.3 0.1 6.1e-56 6.1e-56 2 183 .] 6 185 .. 5 185 .. 0.95 Alignments for each domain: == domain 1 score: 175.3 bits; conditional E-value: 6.1e-56 TIGR00070 2 riAlpKGrleeetlkllekaglklskke..erkliasaedeevevlllrakdiptyvekgaadlGitGk 68 +Al KGr+++etl ll++ag+ + +rkl+++++ ++v+++++ra+d+ptyv++gaadlG+ Gk lcl|NCBI__GCF_002151265.1:WP_010629168.1 6 ILALSKGRILDETLPLLADAGIVPAEDLskSRKLLFDTNLDDVKLVIIRATDVPTYVQMGAADLGVAGK 74 68********************987766689************************************** PP TIGR00070 69 DlleEsead.vvelldlgfgkcklvlAvpeesdvesledlkegkriATkypnltreylekkgvkveivk 136 D+l E++a+ ++e ldl++ kckl+ A + + + +++r+ATk++n++r+y++++g+++e++k lcl|NCBI__GCF_002151265.1:WP_010629168.1 75 DVLLEHGAEgLYEPLDLEIAKCKLMTAGIDGAKPAR-----ARRRVATKFVNVARRYYAEQGIQAEVIK 138 *****99999******************99996655.....468************************* PP TIGR00070 137 leGavElapllgladaIvDivetGttLrengLkiieeilessarlia 183 l+Ga+Elapl++lad IvDiv tG+tLr+ng+ e i +s+rl++ lcl|NCBI__GCF_002151265.1:WP_010629168.1 139 LYGAMELAPLMNLADEIVDIVDTGNTLRANGMSPRELIAPISTRLVV 185 ********************************************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (183 nodes) Target sequences: 1 (220 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 7.91 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory