Align ribose-phosphate diphosphokinase (EC 2.7.6.1) (characterized)
to candidate WP_086509887.1 BZY95_RS10555 ribose-phosphate pyrophosphokinase
Query= BRENDA::P0A719 (315 letters) >NCBI__GCF_002151265.1:WP_086509887.1 Length = 309 Score = 448 bits (1152), Expect = e-131 Identities = 223/308 (72%), Positives = 267/308 (86%), Gaps = 1/308 (0%) Query: 6 LFAGNATPELAQRIANRLYTSLGDAAVGRFSDGEVSVQINENVRGGDIFIIQSTCAPTND 65 +FAGNA PELAQ+IA L T +G+A VG+FSDGE++V+INENVRG D+FI+QSTCAPTND Sbjct: 2 VFAGNANPELAQKIAESLDTRMGNATVGQFSDGEIAVEINENVRGKDVFILQSTCAPTND 61 Query: 66 NLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSVGVDRV 125 NLMEL++MVDALRRASA RITAV+PYFGYARQDRRVRSARVPI+AKVVAD + GVDRV Sbjct: 62 NLMELILMVDALRRASATRITAVVPYFGYARQDRRVRSARVPISAKVVADMMVKAGVDRV 121 Query: 126 LTVDLHAEQIQGFFDVPVDNVFGSPILLEDMLQLNLDNPIVVSPDIGGVVRARAIAKLLN 185 +T+DLHA+QIQGFFDVPVDNV+GSPILL+D+ + N D+ +VVSPD+GGVVRARAIAK LN Sbjct: 122 MTMDLHADQIQGFFDVPVDNVYGSPILLDDIERQNYDDLVVVSPDVGGVVRARAIAKQLN 181 Query: 186 DTDMAIIDKRRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVF 245 D+AIIDKRRP+AN +QVMHIIG++ R CV+VDDMIDT GTLCKA +ALKE GA+RV Sbjct: 182 -ADLAIIDKRRPQANQAQVMHIIGEIENRTCVVVDDMIDTAGTLCKAGDALKEHGARRVV 240 Query: 246 AYATHPIFSGNAANNLRNSVIDEVVVCDTIPLSDEIKSLPNVRTLTLSGMLAEAIRRISN 305 AYATHPI SG A N+ SV+DEVVV DTIPLSD + +R L+++G++AEAIRR+SN Sbjct: 241 AYATHPILSGPAVENITGSVLDEVVVTDTIPLSDVARRSGKIRQLSVAGLIAEAIRRVSN 300 Query: 306 EESISAMF 313 EES+SAMF Sbjct: 301 EESVSAMF 308 Lambda K H 0.321 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 362 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 315 Length of database: 309 Length adjustment: 27 Effective length of query: 288 Effective length of database: 282 Effective search space: 81216 Effective search space used: 81216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate WP_086509887.1 BZY95_RS10555 (ribose-phosphate pyrophosphokinase)
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01251.hmm # target sequence database: /tmp/gapView.24884.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01251 [M=309] Accession: TIGR01251 Description: ribP_PPkin: ribose-phosphate diphosphokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-128 413.0 4.5 3.4e-128 412.8 4.5 1.0 1 lcl|NCBI__GCF_002151265.1:WP_086509887.1 BZY95_RS10555 ribose-phosphate p Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002151265.1:WP_086509887.1 BZY95_RS10555 ribose-phosphate pyrophosphokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 412.8 4.5 3.4e-128 3.4e-128 2 308 .. 1 308 [. 1 309 [] 0.98 Alignments for each domain: == domain 1 score: 412.8 bits; conditional E-value: 3.4e-128 TIGR01251 2 kilsgssskelaekvaknlglelgdvevkkFadgElyvrieesvrgkdvfiivqstsapvndalmelll 70 ++++g++++ela+k+a++l++++g+++v +F+dgE+ v+i+e+vrgkdvfi+ qst+ap+nd+lmel+l lcl|NCBI__GCF_002151265.1:WP_086509887.1 1 MVFAGNANPELAQKIAESLDTRMGNATVGQFSDGEIAVEINENVRGKDVFIL-QSTCAPTNDNLMELIL 68 689*************************************************.**************** PP TIGR01251 71 lidalkrasaksvtaviPyygYaRqdkkak.srepisaklvaklleeaGadrvltvdlHseqiqgfFdv 138 ++dal+rasa ++tav+Py+gYaRqd++++ r pisak+va+++ +aG+drv+t+dlH++qiqgfFdv lcl|NCBI__GCF_002151265.1:WP_086509887.1 69 MVDALRRASATRITAVVPYFGYARQDRRVRsARVPISAKVVADMMVKAGVDRVMTMDLHADQIQGFFDV 137 ****************************9857************************************* PP TIGR01251 139 pvenlsaspklieelkkkelknlvvvsPDkGaverakkvakklglelaiieKeRdskenevevtnllgd 207 pv+n+++sp l++++++++ ++lvvvsPD G+v ra+++ak+l+++laii+K+R+ ++n+++v++++g+ lcl|NCBI__GCF_002151265.1:WP_086509887.1 138 PVDNVYGSPILLDDIERQNYDDLVVVSPDVGGVVRARAIAKQLNADLAIIDKRRP-QANQAQVMHIIGE 205 *******************************************************.888********** PP TIGR01251 208 vegkdvvivDDiisTggTlvkaaelLkekGAkkvivaathgvfsgdAlerlaeagveevivtntilvee 276 +e++++v+vDD+i+T+gTl+ka ++Lke+GA++v+++ath+++sg+A+e+++ ++++ev+vt+ti+ ++ lcl|NCBI__GCF_002151265.1:WP_086509887.1 206 IENRTCVVVDDMIDTAGTLCKAGDALKEHGARRVVAYATHPILSGPAVENITGSVLDEVVVTDTIPLSD 274 *******************************************************************55 PP TIGR01251 277 ..kklpkvseisvapliaeaiarihenesvsslf 308 ++ k++++sva liaeai+r++++esvs++f lcl|NCBI__GCF_002151265.1:WP_086509887.1 275 vaRRSGKIRQLSVAGLIAEAIRRVSNEESVSAMF 308 5899*****************************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (309 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 9.29 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory