Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate WP_010629732.1 BZY95_RS18815 4-hydroxy-tetrahydrodipicolinate synthase
Query= BRENDA::Q9I4W3 (292 letters) >NCBI__GCF_002151265.1:WP_010629732.1 Length = 294 Score = 365 bits (937), Expect = e-106 Identities = 181/292 (61%), Positives = 224/292 (76%), Gaps = 1/292 (0%) Query: 1 MIAGSMVALVTPFDAQGRLDWDSLAKLVDFHLQEGTNAIVAVGTTGESATLDVEEHIQVI 60 MI GS+VAL TP A G +DW++L +LV+FHL+ GT+ IVA GTTGE T+ EH VI Sbjct: 1 MITGSIVALATPMKANGDIDWEALRRLVNFHLENGTDGIVAAGTTGEPTTMSFAEHFDVI 60 Query: 61 RRVVDQVKGRIPVIAGTGANSTREAVALTEAAKSGGADACLLVTPYYNKPTQEGMYQHFR 120 R VV++V GRIPVIAGTGAN+T EAV L A GAD CL V PYYNKPTQEG+Y+HF+ Sbjct: 61 RAVVEEVDGRIPVIAGTGANATSEAVELARYASEVGADYCLSVCPYYNKPTQEGLYRHFK 120 Query: 121 HIAEAVAIPQILYNVPGRTSCDMLPETVERLSKVPNIIGIKEATGDLQRAKEVIERV-GK 179 +AE +P ILYNVPGRT D+ ETV RL++V NIIG+K+ATG+L+RA+++I R+ G Sbjct: 121 AVAEGSRLPVILYNVPGRTCSDLYNETVMRLAEVDNIIGLKDATGNLERAEDLISRLKGS 180 Query: 180 DFLVYSGDDATAVELMLLGGKGNISVTANVAPRAMSDLCAAAMRGDAAAARAINDRLMPL 239 F++YSGDD+TA E ML+GG G+ISVTANVAP+AM +LC AA+ GDA A IN RLMPL Sbjct: 181 GFMLYSGDDSTACEFMLMGGNGDISVTANVAPKAMHELCVAAVAGDADRAHQINTRLMPL 240 Query: 240 HKALFIESNPIPVKWALHEMGLIPEGIRLPLTWLSPRCHEPLRQAMRQTGVL 291 H L IESNPIPVKWALH MGLI +GIRLPLTWLS + H + +A++ GV+ Sbjct: 241 HTNLGIESNPIPVKWALHRMGLIDQGIRLPLTWLSGKYHATVDEALQLAGVI 292 Lambda K H 0.319 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 303 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 294 Length adjustment: 26 Effective length of query: 266 Effective length of database: 268 Effective search space: 71288 Effective search space used: 71288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_010629732.1 BZY95_RS18815 (4-hydroxy-tetrahydrodipicolinate synthase)
to HMM TIGR00674 (dapA: 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00674.hmm # target sequence database: /tmp/gapView.8605.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00674 [M=286] Accession: TIGR00674 Description: dapA: 4-hydroxy-tetrahydrodipicolinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-110 354.5 0.0 1.7e-110 354.3 0.0 1.0 1 lcl|NCBI__GCF_002151265.1:WP_010629732.1 BZY95_RS18815 4-hydroxy-tetrahyd Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002151265.1:WP_010629732.1 BZY95_RS18815 4-hydroxy-tetrahydrodipicolinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 354.3 0.0 1.7e-110 1.7e-110 1 284 [. 4 287 .. 4 289 .. 0.98 Alignments for each domain: == domain 1 score: 354.3 bits; conditional E-value: 1.7e-110 TIGR00674 1 gvltAliTPfkedgsvdfaalekliesqiekgvdaivvvGtTGEsatLsleEkkkvievavelvknrvp 69 g+++Al TP+k++g++d +al +l+++++e+g+d+iv++GtTGE +t+s+ E+ +vi+ +ve v++r+p lcl|NCBI__GCF_002151265.1:WP_010629732.1 4 GSIVALATPMKANGDIDWEALRRLVNFHLENGTDGIVAAGTTGEPTTMSFAEHFDVIRAVVEEVDGRIP 72 589****************************************************************** PP TIGR00674 70 viaGtgsnateeaieltkeaeklgvdgvlvvtPyYnkPtqeGlykhfkaiaeevelPiilYnvPsRtgv 138 viaGtg+nat+ea+el++ a+++g+d +l+v PyYnkPtqeGly+hfka+ae ++lP+ilYnvP+Rt+ lcl|NCBI__GCF_002151265.1:WP_010629732.1 73 VIAGTGANATSEAVELARYASEVGADYCLSVCPYYNKPTQEGLYRHFKAVAEGSRLPVILYNVPGRTCS 141 ********************************************************************* PP TIGR00674 139 slepetvkrLaeeveivaiKeasgdlervseikae.akedfkvlsGdDaltleilalGakGviSVasnv 206 +l+ etv+rLae +i+++K+a+g+ler+ ++++ ++ f ++sGdD+++ e++++G++G iSV++nv lcl|NCBI__GCF_002151265.1:WP_010629732.1 142 DLYNETVMRLAEVDNIIGLKDATGNLERAEDLISRlKGSGFMLYSGDDSTACEFMLMGGNGDISVTANV 210 *****************************99887615678***************************** PP TIGR00674 207 apkelkemvkaalegdteeareihqkllklfkalfietNPipvKtalallgliekdelRlPLtelseek 275 apk ++e++ aa++gd ++a++i+++l++l++ l ie+NPipvK+al+ +gli + +RlPLt ls + lcl|NCBI__GCF_002151265.1:WP_010629732.1 211 APKAMHELCVAAVAGDADRAHQINTRLMPLHTNLGIESNPIPVKWALHRMGLIDQ-GIRLPLTWLSGKY 278 *******************************************************.**********999 PP TIGR00674 276 keklkevlk 284 + +++e+l+ lcl|NCBI__GCF_002151265.1:WP_010629732.1 279 HATVDEALQ 287 999999886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (286 nodes) Target sequences: 1 (294 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.72 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory