Align N-succinyldiaminopimelate-aminotransferase (EC 2.6.1.17) (characterized)
to candidate WP_086509348.1 BZY95_RS07615 succinyldiaminopimelate transaminase
Query= metacyc::MONOMER-6501 (397 letters) >NCBI__GCF_002151265.1:WP_086509348.1 Length = 408 Score = 369 bits (947), Expect = e-107 Identities = 206/404 (50%), Positives = 248/404 (61%), Gaps = 13/404 (3%) Query: 1 MNPRLDALHPYPFEKLRALLADAGKPTHDLPPINLSIGEPKHAAPACVGQAIAANLAGLS 60 MNP LDAL PYPFEKL L A P L I L+IGEP+HA A + A+ + Sbjct: 1 MNPDLDALKPYPFEKLATLKAGVTPPAQ-LAHIPLTIGEPQHAPFAGALATLHAHQLDFA 59 Query: 61 VYPSTKGEPALRQAISQWLSRRYSIPAPDPESEVLPVLGSREALFAFAQTVIDPSAGALV 120 YP+T G P LR AI+ W RR+ + DPE +VLPV G+REA+FAF Q +D S A V Sbjct: 60 RYPATSGIPELRGAIAAWARRRFRLDGLDPERQVLPVNGTREAIFAFVQAALDRSRPARV 119 Query: 121 VCPNPFYQIYEGAALLAGATPYYVNADPARDFGLRTGRVPDEVWRRTQLVFVCSPGNPAG 180 PNPFYQIYEGA LLAG P+Y++ F VP EVWR Q++F+CSPGNP G Sbjct: 120 AVPNPFYQIYEGATLLAGGQPHYLDCRAESGFRPDFDAVPAEVWREVQILFLCSPGNPTG 179 Query: 181 NVMSLEEWRTLFELSDRHGFVIAAYECYSEIYLDEDTPPLGSLQAARRLGRDRYTNLVAF 240 V E++ L L+D F+IA+ ECYSE+YLDED PP G L+A +GR Y + F Sbjct: 180 AVTPRAEFQKLIALADEFDFIIASDECYSELYLDEDAPPPGLLEACAAMGRHDYRRCLVF 239 Query: 241 SSLSKRSNVPGMRSGFVAGDAALLARFLLYRTYHGSAMSPVVSAASIAAWSMRRMCRKTA 300 SLSKRSN+PG+RSGFVAGDA L+A F YRTYHG AMS + ASI AW+ R Sbjct: 240 HSLSKRSNLPGLRSGFVAGDAELIAPFKRYRTYHGCAMSLPLQHASITAWNDEAHVRANR 299 Query: 301 Q-YRAKFEAVLPILQNVLDVRAPQASFYLWAGTP-GSDTAFARELYGRTGVTVLPGSLLA 358 YR KF AV IL VL+ AP+ASFYLW P G D AF REL+ V+VLPGS + Sbjct: 300 DAYREKFAAVTEILAPVLEFPAPEASFYLWPAVPGGDDEAFTRELFAAEHVSVLPGSYMG 359 Query: 359 R----------EAHNANPGQGRIRIALVAPLDQCVQAAERIAHF 392 R + NPG GRIR+ALVA L+ V+AA RI F Sbjct: 360 RPTTGDGRGRADGRGDNPGAGRIRLALVAELEPTVEAAGRIRRF 403 Lambda K H 0.321 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 554 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 408 Length adjustment: 31 Effective length of query: 366 Effective length of database: 377 Effective search space: 137982 Effective search space used: 137982 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate WP_086509348.1 BZY95_RS07615 (succinyldiaminopimelate transaminase)
to HMM TIGR03538 (dapC: succinyldiaminopimelate transaminase (EC 2.6.1.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03538.hmm # target sequence database: /tmp/gapView.30430.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03538 [M=395] Accession: TIGR03538 Description: DapC_gpp: succinyldiaminopimelate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.5e-191 619.9 0.0 1e-190 619.6 0.0 1.1 1 lcl|NCBI__GCF_002151265.1:WP_086509348.1 BZY95_RS07615 succinyldiaminopim Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002151265.1:WP_086509348.1 BZY95_RS07615 succinyldiaminopimelate transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 619.6 0.0 1e-190 1e-190 1 395 [] 1 404 [. 1 404 [. 0.97 Alignments for each domain: == domain 1 score: 619.6 bits; conditional E-value: 1e-190 TIGR03538 1 mnpnlerlkpyPfeklaellkdvtppadleeialsiGePkhatPafvlealvenleelskyPttkGlpe 69 mnp+l++lkpyPfekla+l+++vtppa+l +i+l+iGeP+ha+ a l +l ++ ++++yP+t+G+pe lcl|NCBI__GCF_002151265.1:WP_086509348.1 1 MNPDLDALKPYPFEKLATLKAGVTPPAQLAHIPLTIGEPQHAPFAGALATLHAHQLDFARYPATSGIPE 69 9******************************************************************** PP TIGR03538 70 lreaiaeWlerrfelpagvdperqvlPvnGtrealfafvqavidraekalvvlPnPfyqiyeGaallag 138 lr aia+W++rrf+l +dperqvlPvnGtrea+fafvqa +dr++ a v +PnPfyqiyeGa+llag lcl|NCBI__GCF_002151265.1:WP_086509348.1 70 LRGAIAAWARRRFRLDG-LDPERQVLPVNGTREAIFAFVQAALDRSRPARVAVPNPFYQIYEGATLLAG 137 **************986.*************************************************** PP TIGR03538 139 aepyflnctaengfkpdfdavpeevWkrvqllfvcsPgnPtGavlsleelkklleladkydfiiasdec 207 ++p++l+c ae+gf+pdfdavp+evW++vq+lf+csPgnPtGav + e++kl++lad++dfiiasdec lcl|NCBI__GCF_002151265.1:WP_086509348.1 138 GQPHYLDCRAESGFRPDFDAVPAEVWREVQILFLCSPGNPTGAVTPRAEFQKLIALADEFDFIIASDEC 206 ********************************************************************* PP TIGR03538 208 yselyldeaeaPvGlleaaaelGrddfkrllvfhslskrsnvPGlrsGfvaGdaellkeflryrtyhGc 276 yselylde+++P Gllea+a++Gr+d++r+lvfhslskrsn+PGlrsGfvaGdael++ f+ryrtyhGc lcl|NCBI__GCF_002151265.1:WP_086509348.1 207 YSELYLDEDAPPPGLLEACAAMGRHDYRRCLVFHSLSKRSNLPGLRSGFVAGDAELIAPFKRYRTYHGC 275 ********************************************************************* PP TIGR03538 277 ampiavqlasiaaWedekhvrenralyrekfaavleilgavldlelPdasfylWlkvpdgddeafaral 345 am+++ q+asi+aW+de+hvr+nr++yrekfaav+eil++vl++ +P+asfylW++vp gddeaf+r+l lcl|NCBI__GCF_002151265.1:WP_086509348.1 276 AMSLPLQHASITAWNDEAHVRANRDAYREKFAAVTEILAPVLEFPAPEASFYLWPAVPGGDDEAFTREL 344 ********************************************************************* PP TIGR03538 346 yeeenvkvlpGrylsreae..........gvnPGegrvrlalvaeleecveaaerikkll 395 +++e+v vlpG+y++r + g nPG+gr+rlalvaele +veaa ri++++ lcl|NCBI__GCF_002151265.1:WP_086509348.1 345 FAAEHVSVLPGSYMGRPTTgdgrgradgrGDNPGAGRIRLALVAELEPTVEAAGRIRRFI 404 ***************97642222222222579*************************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (395 nodes) Target sequences: 1 (408 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.02 # Mc/sec: 7.81 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory